Overview

  • Product nameAnti-ST5 antibody
    See all ST5 primary antibodies
  • Description
    Rabbit polyclonal to ST5
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to Human ST5 aa 387-436 (internal sequence).
    Sequence:

    VPKPKRTFEYEADKNPKSKPSNGLPPSPTPAAPPPLPSTPAPPVTRRPKK


    Database link: P78524

  • Positive control
    • 721_B cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab111556 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 126 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionMay be involved in cytoskeletal organization and tumorgenicity. Isoform 1 seems to be involved in a signaling transduction pathway leading to activation of MAPK1/ERK2. Isoform 3 may block ERK2 activation stimulated by ABL1. Isoform 3 may alter cell morphology and cell growth.
  • Tissue specificityWidely expressed with the exception of peripheral blood lymphocytes. Isoform 1 is expressed in several epithelial and fibroblast (including tumorigenic) but absent in lymphoid cell lines (at protein level). Isoform 3 is expressed in primary cell or weakly tumorigenic but not in tumorigenic cell lines (at protein level).
  • Sequence similaritiesContains 1 dDENN domain.
    Contains 1 DENN domain.
    Contains 1 uDENN domain.
  • Information by UniProt
  • Database links
  • Alternative names
    • DENND2B antibody
    • DENN domain containing protein 2B antibody
    • DENN domain-containing protein 2B antibody
    • DENN/MADD domain containing 2B antibody
    • HeLa tumor suppression 1 antibody
    • HTS1 antibody
    • p126 antibody
    • ST 5 antibody
    • ST5 antibody
    • ST5_HUMAN antibody
    • Suppression of tumorigenicity 5 antibody
    • Suppression of tumorigenicity 5 protein antibody
    see all

Anti-ST5 antibody images

  • Anti-ST5 antibody (ab111556) at 1 µg/ml + 721_B whole cell lysate

    Predicted band size : 126 kDa

References for Anti-ST5 antibody (ab111556)

ab111556 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab111556.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"