Overview

  • Product name
  • Description
    Rabbit polyclonal to ST5
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to Human ST5 aa 387-436 (internal sequence).
    Sequence:

    VPKPKRTFEYEADKNPKSKPSNGLPPSPTPAAPPPLPSTPAPPVTRRPKK


    Database link: P78524

  • Positive control
    • 721_B cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab111556 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 126 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function
    May be involved in cytoskeletal organization and tumorgenicity. Isoform 1 seems to be involved in a signaling transduction pathway leading to activation of MAPK1/ERK2. Isoform 3 may block ERK2 activation stimulated by ABL1. Isoform 3 may alter cell morphology and cell growth.
  • Tissue specificity
    Widely expressed with the exception of peripheral blood lymphocytes. Isoform 1 is expressed in several epithelial and fibroblast (including tumorigenic) but absent in lymphoid cell lines (at protein level). Isoform 3 is expressed in primary cell or weakly tumorigenic but not in tumorigenic cell lines (at protein level).
  • Sequence similarities
    Contains 1 dDENN domain.
    Contains 1 DENN domain.
    Contains 1 uDENN domain.
  • Information by UniProt
  • Database links
  • Alternative names
    • DENND2B antibody
    • DENN domain containing protein 2B antibody
    • DENN domain-containing protein 2B antibody
    • DENN/MADD domain containing 2B antibody
    • HeLa tumor suppression 1 antibody
    • HTS1 antibody
    • p126 antibody
    • ST 5 antibody
    • ST5 antibody
    • ST5_HUMAN antibody
    • Suppression of tumorigenicity 5 antibody
    • Suppression of tumorigenicity 5 protein antibody
    see all

Images

  • Anti-ST5 antibody (ab111556) at 1 µg/ml + 721_B whole cell lysate

    Predicted band size : 126 kDa

References

ab111556 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab111556.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up