Overview

  • Product nameAnti-ST6GAL2 antibody
    See all ST6GAL2 primary antibodies
  • Description
    Rabbit polyclonal to ST6GAL2
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse
    Predicted to work with: Rat, Rabbit, Chicken, Guinea pig, Cow, Cat, Dog, Pig, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within C-terminal amino acids 286-335 (

    RGLSSCAVVMSAGAILNSSLGEEIDSHDAVLRFNSAPTRGYEKDVGNKTT

    ) of Mouse ST6GAL2 (NP_766417).

  • Positive control
    • Mouse small intestine lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferConstituents: 97% PBS, 2% Sucrose
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab113805 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 60 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionTransfers sialic acid from the donor of substrate CMP-sialic acid to galactose containing acceptor substrates. Has alpha-2,6-sialyltransferase activity toward oligosaccharides that have the Gal-beta-1,4-GlcNAc sequence at the non-reducing end of their carbohydrate groups, but it has weak or no activities toward glycoproteins and glycolipids.
  • Tissue specificityWeakly expressed in some tissues, such as small intestine, colon and fetal brain.
  • Sequence similaritiesBelongs to the glycosyltransferase 29 family.
  • Cellular localizationGolgi apparatus > Golgi stack membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • 6-sialyltransferase 2 antibody
    • 6-ST 2 antibody
    • Alpha 2 antibody
    • Alpha 2,6 ST 2 antibody
    • beta galactoside alpha 2,6 sialyltransferase II antibody
    • Beta-galactoside alpha-2 antibody
    • CMP N acetylneuraminate beta galactosamide alpha 2,6 sialyltransferase antibody
    • CMP-N-acetylneuraminate-beta-galactosamide-alpha-2 antibody
    • EC 2.4.99.1 antibody
    • FLJ30711 antibody
    • FLJ37730 antibody
    • FLJ38334 antibody
    • hST6Gal II antibody
    • KIAA1877 antibody
    • Sialyltransferase 2 antibody
    • SIAT2 antibody
    • SIAT2_HUMAN antibody
    • ST6 beta galactosamide alpha 2,6 sialyltranferase 2 antibody
    • ST6Gal II antibody
    • ST6GAL2 antibody
    • ST6GalII antibody
    see all

Anti-ST6GAL2 antibody images

  • Anti-ST6GAL2 antibody (ab113805) at 1 µg/ml + Mouse small intestine lysate at 10 µg

    Predicted band size : 60 kDa

References for Anti-ST6GAL2 antibody (ab113805)

ab113805 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113805.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"