Overview

  • Product name
  • Description
    Rabbit polyclonal to STARS
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse, Human
    Predicted to work with: Rat, Rabbit, Horse, Chicken, Cow, Cat, Dog, Pig, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within C terminal amino acids 284-333 (

    KEGSKTAERAKRAEEHIYREIMELCFVIRTMARHRRDGKIQVTFGELFDR

    ) of Mouse STARS (NP_780665).

  • Positive control
    • Mouse heart lysate

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    Constituents: 2% Sucrose, 97% PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab116046 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 53 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function
    Acts as an activator of serum response factor (SRF)-dependent transcription possibly by inducing nuclear translocation of MKL1 or MKL2 and through a mechanism requiring Rho-actin signaling.
  • Cellular localization
    Cytoplasm > myofibril > sarcomere. Cytoplasm > cytoskeleton. Localized to the I-band of the sarcomere and to a lesser extent to the sarcomeric structure between Z-lines.
  • Information by UniProt
  • Database links
  • Alternative names
    • ABRA antibody
    • ABRA_HUMAN antibody
    • Actin-binding Rho activating protein antibody
    • Actin-binding Rho-activating protein antibody
    • Hypothetical protein FLJ35375 antibody
    • STARS antibody
    • Striated muscle activator of Rho dependent signaling antibody
    • Striated muscle activator of Rho-dependent signaling antibody
    see all

Images

  • Anti-STARS antibody (ab116046) at 100 µg/ml + Mouse heart lysate at 10 µg

    Predicted band size : 53 kDa

References

ab116046 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116046.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up