Overview

  • Product nameAnti-STARS antibody
    See all STARS primary antibodies
  • Description
    Rabbit polyclonal to STARS
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse, Human
    Predicted to work with: Rat, Rabbit, Horse, Chicken, Cow, Cat, Dog, Pig, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within C terminal amino acids 284-333 (

    KEGSKTAERAKRAEEHIYREIMELCFVIRTMARHRRDGKIQVTFGELFDR

    ) of Mouse STARS (NP_780665).

  • Positive control
    • Mouse heart lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferConstituents: 2% Sucrose, 97% PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab116046 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 53 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionActs as an activator of serum response factor (SRF)-dependent transcription possibly by inducing nuclear translocation of MKL1 or MKL2 and through a mechanism requiring Rho-actin signaling.
  • Cellular localizationCytoplasm > myofibril > sarcomere. Cytoplasm > cytoskeleton. Localized to the I-band of the sarcomere and to a lesser extent to the sarcomeric structure between Z-lines.
  • Information by UniProt
  • Database links
  • Alternative names
    • ABRA antibody
    • ABRA_HUMAN antibody
    • Actin-binding Rho activating protein antibody
    • Actin-binding Rho-activating protein antibody
    • Hypothetical protein FLJ35375 antibody
    • STARS antibody
    • Striated muscle activator of Rho dependent signaling antibody
    • Striated muscle activator of Rho-dependent signaling antibody
    see all

Anti-STARS antibody images

  • Anti-STARS antibody (ab116046) at 100 µg/ml + Mouse heart lysate at 10 µg

    Predicted band size : 53 kDa

References for Anti-STARS antibody (ab116046)

ab116046 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116046.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"