Overview

  • Product nameAnti-STAT5b antibody
    See all STAT5b primary antibodies
  • Description
    Rabbit polyclonal to STAT5b
  • Tested applicationsSuitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Sheep, Rabbit, Goat, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig, Zebrafish
  • Immunogen

    A synthetic peptide corresponding to a region within N terminal amino acids 2-51(

    AVWIQAQQLQGEALHQMQALYGQHFPIEVRHYLSQWIESQAWDSVDLDNP

    ) of Human STAT5b (NP_036580)

  • Positive control
    • Transfected 293T cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab86586 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 mg/ml.
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 90 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionCarries out a dual function: signal transduction and activation of transcription. Mediates cellular responses to the cytokine KITLG/SCF and other growth factors. Binds to the GAS element and activates PRL-induced transcription.
  • Involvement in diseaseGrowth hormone insensitivity with immunodeficiency
  • Sequence similaritiesBelongs to the transcription factor STAT family.
    Contains 1 SH2 domain.
  • Post-translational
    modifications
    Tyrosine phosphorylated in response to signaling via activated KIT, resulting in translocation to the nucleus. Tyrosine phosphorylated in response to signaling via activated FLT3; wild-type FLT3 results in much weaker phosphorylation than constitutively activated mutant FLT3. Alternatively, can be phosphorylated by JAK2. Phosphorylation at Tyr-699 by PTK6 or HCK leads to an increase of its transcriptional activity. Dephosphorylation on tyrosine residues by PTPN2 negatively regulates prolactin signaling pathway.
  • Cellular localizationCytoplasm. Nucleus. Translocated into the nucleus in response to phosphorylation.
  • Information by UniProt
  • Database links
  • Alternative names
    • Signal transducer and activator of transcription 5B antibody
    • STA5B_HUMAN antibody
    • STAT5 antibody
    • Stat5b antibody
    • Transcription factor STAT5B antibody
    see all

Anti-STAT5b antibody images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human placenta tissue labelling STAT5b with ab86586 ay 5µg/ml.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human prostate tissue labelling STAT5b with ab86586 ay 5µg/ml.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human placenta tissue labelling STAT5b with ab86586 ay 5µg/ml.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human testis tissue labelling STAT5b with ab86586 ay 5µg/ml.

  • Anti-STAT5b antibody (ab86586) at 1 µg/ml + transfected 293T cell lysate at 10 µg

    Secondary
    HRP-conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 90 kDa
    Observed band size : 90 kDa
    Gel concentration 12%

References for Anti-STAT5b antibody (ab86586)

ab86586 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab86586.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"