
  • Product name
  • Description
    Rabbit polyclonal to STK16
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Goat, Horse, Guinea pig, Cow, Cat, Dog, Pig, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within the internal sequence amino acids 215-264 (TDVWSLGCVLYAMMFGEGPYDMVFQKGDSVALAVQNQLSIPQSPRHSSA L) of Human STK16, NP_003682

  • Positive control
    • Fetal brain lysate (Human)


  • Form
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
  • Isotype
  • Research areas


Our Abpromise guarantee covers the use of ab85638 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 35 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


  • Function
    Protein kinase that act on both serine and threonine residues.
  • Tissue specificity
    Ubiquitously expressed at very low levels.
  • Sequence similarities
    Belongs to the protein kinase superfamily. Ser/Thr protein kinase family.
    Contains 1 protein kinase domain.
  • Post-translational
    Autophosphorylated on serine and threonine residues.
    It is uncertain whether palmitoylation is on Cys-6 and/or Cys-8.
  • Cellular localization
  • Information by UniProt
  • Database links
  • Alternative names
    • EDPK antibody
    • F52 antibody
    • FLJ39635 antibody
    • hPSK antibody
    • KRCT antibody
    • MGC16211 antibody
    • MPSK antibody
    • MPSK1 antibody
    • Myristoylated and palmitoylated serine/threonine protein kinase antibody
    • Myristoylated and palmitoylated serine/threonine-protein kinase antibody
    • PKL12 antibody
    • Protein kinase expressed in day 12 fetal liver antibody
    • Protein kinase Krct antibody
    • Protein kinase PKL12 antibody
    • Serine/threonine kinase 16 antibody
    • Serine/threonine protein kinase 16 antibody
    • Serine/threonine-protein kinase 16 antibody
    • Stk16 antibody
    • STK16_HUMAN antibody
    • TGF beta stimulated factor 1 antibody
    • TGF-beta-stimulated factor 1 antibody
    • TGFB stimulated factor 1 antibody
    • Transforming growth factor beta stimulated factor 1 antibody
    • TSF-1 antibody
    • TSF1 antibody
    • Tyrosine protein kinase STK16 antibody
    see all

Anti-STK16 antibody images

  • Anti-STK16 antibody (ab85638) at 1 µg/ml + Fetal brain lysate (Human) at 10 µg

    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 35 kDa

References for Anti-STK16 antibody (ab85638)

ab85638 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab85638.
Please use the links above to contact us or submit feedback about this product.


Sign up