Overview

  • Product name
  • Description
    Rabbit polyclonal to STK25
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Cow
  • Immunogen

    Full length protein corresponding to Human STK25 aa 1-426.
    Sequence:

    MAHLRGFANQHSRVDPEELFTKLDRIGKGSFGEVYKGIDNHTKEVVAIKI IDLEEAEDEIEDIQQEITVLSQCDSPYITRYFGSYLKSTKLWIIMEYLGG GSALDLLKPGPLEETYIATILREILKGLDYLHSERKIHRDIKAANVLLSE QGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDFKADIWS LGITAIELAKGEPPNSDLHPMRVLFLIPKNSPPTLEGQHSKPFKEFVEAC LNKDPRFRPTAKELLKHKFITRYTKKTSFLTELIDRYKRWKSEGHGEESS SEDSDIDGEAEDGEQGPIWTFPPTIRPSPHSKLHKGTALHSSQKPAEPVK RQPRSQCLSTLVRPVFGELKEKHKQSGGSVGALEELENAFSLAEESCPGI SDKLMVHLVERVQRFSHNRNHLTSTR


    Database link: NP_006365.2

  • Positive control
    • STK25 transfected 293T cell line lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab172393 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 48 kDa.

Target

  • Function
    Oxidant stress-activated serine/threonine kinase that may play a role in the response to environmental stress. Targets to the Golgi apparatus where it appears to regulate protein transport events, cell adhesion, and polarity complexes important for cell migration.
  • Tissue specificity
    Ubiquitously expressed. Highest levels are found in testis, large intestine, brain and stomach followed by heart and lung.
  • Sequence similarities
    Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Cytoplasm. Golgi apparatus. Localizes to the Golgi apparatus.
  • Information by UniProt
  • Database links
  • Alternative names
    • C86992 antibody
    • Serine/threonine kinase 25 antibody
    • Serine/threonine kinase 25 (STE20 homolog, yeast) antibody
    • Serine/threonine kinase 25 (STE20 homolog, yeast), isoform CRA_a antibody
    • Serine/threonine kinase 25 (yeast) antibody
    • Serine/threonine protein kinase 25 antibody
    • Serine/threonine-protein kinase 25 antibody
    • SOK 1 antibody
    • SOK-1 antibody
    • SOK1 antibody
    • Ste20 like kinase antibody
    • Ste20 yeast homolog antibody
    • Ste20-like antibody
    • STE20-like kinase antibody
    • Ste20/oxidant stress response kinase 1 antibody
    • Sterile 20 (oxidant stress response kinase 1) antibody
    • Sterile 20/oxidant stress-response kinase 1 antibody
    • STK25 antibody
    • STK25_HUMAN antibody
    • Yeast Sps1/Ste20 related kinase 1 antibody
    • YSK 1 antibody
    • YSK1 antibody
    see all

Images

  • All lanes : Anti-STK25 antibody (ab172393) at 1 µg/ml

    Lane 1 : STK25 transfected 293T cell line lysate
    Lane 2 : Non-transfected 293T cell line lysate

    Secondary
    All lanes : Goat Anti-Rabbit IgG (H+L), Peroxidase Conjugated at 1/7500 dilution

    Predicted band size: 48 kDa

References

ab172393 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172393.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up