Overview

  • Product name
    Anti-STOM antibody [AT33F5]
    See all STOM primary antibodies
  • Description
    Mouse monoclonal [AT33F5] to STOM
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human STOM aa 55-288. cytoplasmic domain purified from E. coli.
    Sequence:

    KIIKEYERAIIFRLGRILQGGAKGPGLFFILPCTDSFIKVDMRTISFDIP PQEILTKDSV TISVDGVVYYRVQNATLAVANITNADSATRLLAQTTLR NVLGTKNLSQILSDREEIAHNM QSTLDDATDAWGIKVERVEIKDVKLP VQLQRAMAAEAEASREARAKVIAAEGEMNASRAL KEASMVITESPAAL QLRYLQTLTTIAAEKNSTIVFPLPIDMLQGIIGAKHSHLG


    Database link: P27105

  • Positive control
    • HeLa cell lysate.
  • General notes

    ab183196 is derived from hybridization of mouse F0 myeloma cells with
    spleen cells from BALB/c mice immunized with a recombinant Human STOM protein.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: 89% PBS, 10% Glycerol
  • Concentration information loading...
  • Purity
    Protein A purified
  • Clonality
    Monoclonal
  • Clone number
    AT33F5
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab183196 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Predicted molecular weight: 32 kDa.

Target

  • Function
    Thought to regulate cation conductance. May regulate ACCN1 and ACCN3 gating.
  • Tissue specificity
    Widely expressed.
  • Sequence similarities
    Belongs to the band 7/mec-2 family.
  • Cellular localization
    Cell membrane. Cell membrane. Melanosome. Exposed on the cytoplasmic surface of the membrane. Associated with lipid rafts. Concentrates preferentially in plasma membrane protrusions and in a juxta-nuclear region which may represent Golgi-derived vesicles. Colocalizes with actin. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
  • Information by UniProt
  • Database links
  • Alternative names
    • BND7 antibody
    • EPB7 antibody
    • EPB72 antibody
    • Erythrocyte band 7 integral membrane protein antibody
    • Erythrocyte membrane protein band 7.2 (stomatin) antibody
    • Erythrocyte surface protein band 7.2 antibody
    • Protein 7.2b antibody
    • STOM antibody
    • STOM_HUMAN antibody
    • Stomatin antibody
    see all

Images

  • Anti-STOM antibody [AT33F5] (ab183196) at 1/1000 dilution + HeLa cell lysate at 40 µg

    Secondary
    goat anti-mouse conjugated to HRP

    Predicted band size : 32 kDa

References

ab183196 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab183196.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up