Overview

  • Product name
  • Description
    Rabbit polyclonal to STOX2
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Macaque monkey
  • Immunogen

    Recombinant fragment corresponding to Human STOX2 aa 159-257.
    Sequence:

    HLDERIPDRSQCTSPQPGTITPSASGCVRERTLPRNHCDSCHCCREDVHS THAPTLQRKSAKDCKDPYCPPSLCQVPPTEKSKSTVNFSYKTETLSKPK


    Database link: Q9P2F5

  • Positive control
    • Human testis tissue; U251 MG cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab185112 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 103 kDa.

Target

Images

  • All lanes : Anti-STOX2 antibody (ab185112) at 1/100 dilution

    Lane 1 : RT4 cell lysate
    Lane 2 : U251 MG cell lysate


    Predicted band size : 103 kDa
  • Immunohistochemical analysis of Paraffin-embedded Human testis tissue labeling STOX2 with ab185112 at 1/50 dilution.

References

ab185112 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185112.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up