Anti-STYXL1 antibody - N-terminal (ab185098)

Overview

  • Product name
    Anti-STYXL1 antibody - N-terminal
    See all STYXL1 primary antibodies
  • Description
    Rabbit polyclonal to STYXL1 - N-terminal
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human STYXL1 aa 2-103 (N terminal).
    Sequence:

    PGLLLCEPTELYNILNQATKLSRLTDPNYLCLLDVRSKWEYDESHVITAL RVKKKNNEYLLPESVDLECVKYCVVYDNNSSTLEILLKDDDDDSDSDGDG KD


    Database link: Q9Y6J8

  • Positive control
    • Human kidney tissue

Properties

Applications

Our Abpromise guarantee covers the use of ab185098 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function
    Probable pseudophosphatase. Contains a Ser residue instead of a conserved Cys residue in the dsPTPase catalytic loop which probably renders it catalytically inactive as a phosphatase. The binding pocket may be however sufficiently preserved to bind phosphorylated substrates, and maybe protect them from phosphatases.
  • Sequence similarities
    Belongs to the protein-tyrosine phosphatase family. Non-receptor class subfamily.
    Contains 1 rhodanese domain.
    Contains 1 tyrosine-protein phosphatase domain.
  • Information by UniProt
  • Database links
  • Alternative names
    • Dual specificity phosphatase inhibitor MK STYX antibody
    • Dual specificity phosphatase inhibitor MK-STYX antibody
    • Dual specificity protein phosphatase 24 antibody
    • DUSP24 antibody
    • Map kinase phosphatase like protein MK STYX antibody
    • Map kinase phosphatase-like protein MK-STYX antibody
    • MKSTYX antibody
    • Serine/threonine/tyrosine interacting like protein 1 antibody
    • Serine/threonine/tyrosine-interacting-like protein 1 antibody
    • STYL1_HUMAN antibody
    • STYXL1 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human kidney tissue labeling STYXL1 with ab185098 at 1/20 dilution.

References

ab185098 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185098.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up