Anti-SUMF1 antibody - N-terminal (ab178809)

Overview

  • Product name
    Anti-SUMF1 antibody - N-terminal
    See all SUMF1 primary antibodies
  • Description
    Rabbit polyclonal to SUMF1 - N-terminal
  • Tested applications
    Suitable for: ICC/IF, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide within Human SUMF1 aa 71-120 (N terminal). The exact sequence is proprietary. (NP_877437).
    Sequence:

    SREANAPGPVPGERQLAHSKMVPIPAGVFTMGTDDPQIKQDGEAPARRVT


    Database link: Q8NBK3

  • Positive control
    • PANC1 whole cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab178809 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50.
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 41 kDa.

Target

  • Function
    Using molecular oxygen and an unidentified reducing agent, oxidizes a cysteine residue in the substrate sulfatase to an active site 3-oxoalanine residue, which is also called C(alpha)-formylglycine. Known substrates include GALNS, ARSA, STS and ARSE.
  • Tissue specificity
    Ubiquitous. Highly expressed in kidney, pancreas and liver. Detected at lower levels in leukocytes, lung, placenta, small intestine, skeletal muscle and heart.
  • Pathway
    Protein modification; sulfatase oxidation.
  • Involvement in disease
    Defects in SUMF1 are the cause of multiple sulfatase deficiency (MSD) [MIM:272200]. MSD is a clinically and biochemically heterogeneous disorder caused by the simultaneous impairment of all sulfatases, due to defective post-translational modification and activation. It combines features of individual sulfatase deficiencies such as metachromatic leukodystrophy, mucopolysaccharidosis, chondrodysplasia punctata, hydrocephalus, ichthyosis, neurologic deterioration and developmental delay. Inheritance is autosomal recessive.
  • Sequence similarities
    Belongs to the sulfatase-modifying factor family.
  • Post-translational
    modifications
    N-glycosylated. Contains high-mannose-type oligosaccharides.
  • Cellular localization
    Endoplasmic reticulum lumen.
  • Information by UniProt
  • Database links
  • Alternative names
    • MGC150436 antibody
    • AAPA3037 antibody
    • C alpha formylglycine generating enzyme 1 antibody
    • C-alpha-formylglycine-generating enzyme 1 antibody
    • FGE antibody
    • FGly generating enzyme antibody
    • MGC131853 antibody
    • Sulfatase modifying factor 1 [Precursor] antibody
    • Sulfatase-modifying factor 1 antibody
    • SUMF1 antibody
    • SUMF1_HUMAN antibody
    • UNQ3037 antibody
    see all

Images

  • Anti-SUMF1 antibody - N-terminal (ab178809) at 1 µg/ml + PANC1 whole cell lysate at 10 µg

    Predicted band size : 41 kDa

References

ab178809 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunocytochemistry/ Immunofluorescence
Blocking step
Serum as blocking agent for 20 minute(s) · Concentration: 1% · Temperature: 20°C
Sample
Human Cell (Lung Fibroblast)
Specification
Lung Fibroblast
Permeabilization
Yes - 0.5% Saponin in 1xPBS
Fixative
Paraformaldehyde
Username

Dr. Julie Weidner

Verified customer

Submitted Oct 10 2014

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up