Overview

  • Product nameAnti-SUNC1 antibody
    See all SUNC1 primary antibodies
  • Description
    Rabbit polyclonal to SUNC1
  • Tested applicationsSuitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide, corresponding to a region within C terminal amino acids 253-302 ATKIIPTAVTMEHISEKVSPSGNISSAPKEFSVYGITKKCEGEEIFLGQF of Human SUNC1, NP_001025190

  • Positive control
    • HepG2 cell lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab81495 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 40 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay: 1:312500.

Target

  • RelevanceSUNC1 is a single-pass membrane protein. It contains 1 Unc84 (SUN) domain.
  • Cellular localizationMembrane; Single-pass membrane protein
  • Database links
  • Alternative names
    • D630047F21Rik antibody
    • MGC130135 antibody
    • MGC33329 antibody
    • OTTHUMP00000208375 antibody
    • OTTHUMP00000208377 antibody
    • RP23-219P13.2 antibody
    • Sad1 and UNC84 domain containing 1 antibody
    • Sad1/unc 84 domain containing protein 1 antibody
    • SUN domain containing protein 3 antibody
    • SUN3 antibody
    see all

Anti-SUNC1 antibody images

  • Anti-SUNC1 antibody (ab81495) at 1 µg/ml (in 5% skim milk / PBS buffer) + HepG2 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 40 kDa
    Observed band size : 38 kDa (why is the actual band size different from the predicted?)

References for Anti-SUNC1 antibody (ab81495)

ab81495 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab81495.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"