Anti-Superoxide Dismutase 4 antibody (ab113915)

Overview

  • Product name
    Anti-Superoxide Dismutase 4 antibody
    See all Superoxide Dismutase 4 primary antibodies
  • Description
    Rabbit polyclonal to Superoxide Dismutase 4
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Sheep, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Pig, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 126-175 (

    LHGLHVHQYGDLTNNCNSCGNHFNPDGASHGGPQDSDRHRGDLGNVRADA

    ) of Human Superoxide Dismutase 4 (NP_005116).

  • Positive control
    • Human Fetal Liver Lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab113915 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 29 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Images

  • Anti-Superoxide Dismutase 4 antibody (ab113915) at 1 µg/ml + Human Fetal Liver Lysate at 10 µg

    Predicted band size : 29 kDa

References

ab113915 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab113915.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up