Overview

  • Product name
  • Description
    Rabbit polyclonal to SYBL1
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Mouse, Chicken
    Predicted to work with: Rat, Cow, Human
  • Immunogen

    Recombinant fragment corresponding to Chicken SYBL1 aa 2-181.
    Sequence:

    MAILFAVVARGTTILAKHAWCGGNFLEVTEQILAKIPSENNKLTYSHGNY LFHYICQDRIIYLCITDDDFERSRAFNFLNEIKKRFQTTYGSRAQTALPY AMNSEFSSVLAAQLKYHSESKGTDQVAETQAQVDELKGIMVRNIDLVAQR GEKLELLIDKTENLVDSSVTFKTTSRNLAR A


    Database link: Q5ZL74

  • Positive control
    • Mouse liver tissue

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity
    Protein G purified
  • Purification notes
    >95%,Protein G purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab193200 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function
    Involved in the targeting and/or fusion of transport vesicles to their target membrane during transport of proteins from the early endosome to the lysosome. Required for heterotypic fusion of late endosomes with lysosomes and homotypic lysosomal fusion. Required for calcium regulated lysosomal exocytosis. Involved in the export of chylomicrons from the endoplasmic reticulum to the cis Golgi. Required for exocytosis of mediators during eosinophil and neutrophil degranulation, and target cell killing by natural killer cells. Required for focal exocytosis of late endocytic vesicles during phagosome formation.
  • Tissue specificity
    Detected in all tissues tested.
  • Sequence similarities
    Belongs to the synaptobrevin family.
    Contains 1 longin domain.
    Contains 1 v-SNARE coiled-coil homology domain.
  • Cellular localization
    Cytoplasmic vesicle > secretory vesicle membrane. Golgi apparatus > trans-Golgi network membrane. Late endosome membrane. Lysosome membrane. Endoplasmic reticulum membrane. Cytoplasmic vesicle > phagosome membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • FLJ53045 antibody
    • FLJ53762 antibody
    • FLJ54296 antibody
    • HGNC:11486 antibody
    • OTTHUMP00000024258 antibody
    • OTTHUMP00000024259 antibody
    • OTTHUMP00000225953 antibody
    • SYBL 1 antibody
    • SYBL1 antibody
    • Synaptobrevin like 1 antibody
    • Synaptobrevin-like protein 1 antibody
    • Tetanus insensitive VAMP antibody
    • Tetanus neurotoxin insensitive VAMP antibody
    • Tetanus-insensitive VAMP antibody
    • TI VAMP antibody
    • Ti-VAMP antibody
    • TIVAMP antibody
    • VAMP-7 antibody
    • VAMP7 antibody
    • VAMP7_HUMAN antibody
    • Vesicle-associated membrane protein 7 antibody
    see all

Images

  • Immunohistochemical analysis of Formalin-fixed, paraffin-embedded mouse liver labeling SYBL1 with ab193200 at 1/50 dilution

References

ab193200 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab193200.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up