Anti-Syndecan 3 antibody (ab113893)

Overview

  • Product nameAnti-Syndecan 3 antibody
    See all Syndecan 3 primary antibodies
  • Description
    Rabbit polyclonal to Syndecan 3
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse
    Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within N-terminal amino acids 27-76 (

    GLLLPPLLLLLLAGRAAGAQRWRNENFERPVDLEGSGDDDSFPDDELDDL

    ) of Mouse Syndecan 3 (NP_035650).

  • Positive control
    • Mouse Heart Lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage bufferConstituents: 98% PBS, 2% Sucrose
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab113893 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 45 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionCell surface proteoglycan that may bear heparan sulfate (By similarity). May have a role in the organization of cell shape by affecting the actin cytoskeleton, possibly by transferring signals from the cell surface in a sugar-dependent mechanism.
  • Tissue specificityExpressed in the nervous system, the adrenal gland, and the spleen.
  • Sequence similaritiesBelongs to the syndecan proteoglycan family.
  • Post-translational
    modifications
    O-glycosylated within the Thr/Ser-rich region which could interact with lectin domains on other molecules.
  • Cellular localizationMembrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • N-syndecan antibody
    • Sdc3 antibody
    • SDC3_HUMAN antibody
    • SDCN antibody
    • SYND3 antibody
    • Syndecan neural type antibody
    • syndecan proteoglycan 3 antibody
    • Syndecan-3 antibody
    see all

Anti-Syndecan 3 antibody images

  • Anti-Syndecan 3 antibody (ab113893) at 1 µg/ml + Mouse Heart Lysate at 10 µg

    Predicted band size : 45 kDa

References for Anti-Syndecan 3 antibody (ab113893)

ab113893 has not yet been referenced specifically in any publications.

Product Wall

Abcam has not validated the combination of species/application used in this Abreview.
Application Immunohistochemistry (Frozen sections)
Sample Mouse Tissue sections (E12 Mouse transversal sections)
Specification E12 Mouse transversal sections
Fixative Paraformaldehyde
Permeabilization Yes - Triton X100 0.1%
Blocking step Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 20°C
Username

Abcam user community

Verified customer

Submitted Aug 03 2012

Thank you for your reply.
I am happy to confirm that we are happy to extent the testing discount to the testing of IHC-Fr (PFA-fixed). And I agree that this is a good plan.
Please remember the testing discount code will also valid in case the...

Read More

DISCOUNT CODE for ab63932: 100%0000000
DISCOUNT CODE for ab113893: 100%000000
Ablaufdatum: 30. September 2012
Es freut mich zu hören, dass Sie unser Angebot unseren Antikörper ab63932 und ab113893 in "whole mount IHC" zu testen, annehmen...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"