Overview

Description

  • Nature
    Synthetic
  • Source
    Synthetic
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHC LHPKLQSTKRFIKWYNAWNEKRRVYEE
    • Molecular weight
      9 kDa
    • Amino acids
      35 to 111

Associated products

Specifications

Our Abpromise guarantee covers the use of ab174986 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

  • Reconstitution
    It is recommended vials be centrifuged prior to opening. Water can be used to prepare stock solutions of 20 µmol.L-1. Stock solutions with up to 30% DMSO/water can also be prepared.

General Info

  • Alternative names
    • 1110031L23Rik
    • 1200006I23Rik
    • AI414372
    • BMAC
    • bolekine
    • BRAK
    • Breast and kidney
    • C-X-C motif chemokine 14
    • C-X-C motif chemokine ligand 14
    • Chaemokine, CXC motif, ligand 14
    • Chemokine (C-X-C motif) ligand 14
    • Chemokine BRAK
    • CXC chemokine in breast and kidney
    • CXCL14
    • CXL14_HUMAN
    • JSC
    • Kec
    • Kidney-expressed chemokine CXC
    • KS1
    • MGC10687
    • MGC124510
    • MGC90667
    • MIP 2 gamma
    • MIP-2G
    • MIP2G
    • MIP2gamma
    • NJAC
    • PRO273
    • PSEC0212
    • Scyb14
    • Small Inducible Cytokine B14
    • Small inducible cytokine subfamily B (Cys-X-Cys) member 14 (BRAK)
    • Small Inducible Cytokine subfamily B, member 14
    • Small-inducible cytokine B14
    • Tumor suppressing chemokine
    • UNQ240
    see all
  • Function
    Potent chemoattractant for neutrophils, and weaker for dendritic cells. Not chemotactive for T-cells, B-cells, monocytes, natural killer cells or granulocytes. Does not inhibit proliferation of myeloid progenitors in colony formation assays.
  • Tissue specificity
    Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Highly expressed in normal tissue without inflammatory stimuli and infrequently expressed in cancer cell lines. Weakly expressed in monocyte-derived dendritic cells. Not detected in lung or unstimulated peripheral blood lymphocytes.
  • Sequence similarities
    Belongs to the intercrine alpha (chemokine CxC) family.
  • Cellular localization
    Secreted.
  • Information by UniProt

References

ab174986 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174986.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up