Overview

  • Product name
  • Description
    Mouse polyclonal to TAB2
  • Host species
    Mouse
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Full length protein corresponding to Human TAB2 aa 1-693.
    Sequence:

    MAQGSHQIDFQVLHDLRQKFPEVPEVVVSRCMLQNNNNLDACCAVLSQES TRYLYGEGDLNFSDDSGISGLRNHMTSLNLDLQSQNIYHHGREGSRMNGS RTLTHSISDGQLQGGQSNSELFQQEPQTAPAQVPQGFNVFGMSSSSGASN SAPHLGFHLGSKGTSSLSQQTPRFNPIMVTLAPNIQTGRNTPTSLHIHGV PPPVLNSPQGNSIYIRPYITTPGGTTRQTQQHSGWVSQFNPMNPQQVYQP SQPGPWTTCPASNPLSHTSSQQPNQQGHQTSHVYMPISSPTTSQPPTIHS SGSSQSSAHSQYNIQNISTGPRKNQIEIKLEPPQRNNSSKLRSSGPRTSS TSSSVNSQTLNRNQPTVYIAASPPNTDELMSRSQPKVYISANAATGDEQV MRNQPTLFISTNSGASAASRNMSGQVSMGPAFIHHHPPKSRAIGNNSATS PRVVVTQPNTKYTFKITVSPNKPPAVSPGVVSPTFELTNLLNHPDHYVET ENIQHLTDPTLAHVDRISETRKLSMGSDDAAYTQALLVHQKARMERLQRE LEIQKKKLDKLKSEVNEMENNLTRRRLKRSNSISQIPSLEEMQQLRSCNR QLQIDIDCLTKEIDLFQARGPHFNPSAIHNFYDNIGFVGPVPPKPKDQRS IIKTPKTQDTEDDEGAQWNCTACTFLNHPALIRCEQCEMPRHF


    Database link: NP_055908

  • Positive control
    • TAB2 transfected 293T cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab172412 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 76 kDa.

Target

  • Function
    Adapter linking MAP3K7/TAK1 and TRAF6. Promotes MAP3K7 activation in the IL1 signaling pathway. The binding of 'Lys-63'-linked polyubiquitin chains to TAB2 promotes autophosphorylation of MAP3K7 at 'Thr-187'. Involved in heart development.
  • Tissue specificity
    Widely expressed. In the embryo, expressed in the ventricular trabeculae, endothelial cells of the conotruncal cushions of the outflow tract and in the endothelial cells lining the developing aortic valves.
  • Involvement in disease
    Defects in TAB2 are the cause of congenital heart disease non-syndromic type 2 (CHTD2) [MIM:612863]. It is a disease characterized by congenital developmental abnormalities involving structures of the heart. Clinical features include left ventricular outflow tract obstruction, subaortic stenosis, residual aortic regurgitation, atrial fibrillation, bicuspid aortic valve and aortic dilation. Note=A chromosomal aberration involving TAB2 has been found in a family with congenital heart disease. Translocation t(2;6)(q21;q25).
  • Sequence similarities
    Contains 1 CUE domain.
    Contains 1 RanBP2-type zinc finger.
  • Post-translational
    modifications
    Ubiquitinated; following IL1 stimulation or TRAF6 overexpression. Ubiquitination involves RBCK1 leading to proteasomal degradation.
    Phosphorylated.
  • Cellular localization
    Membrane. Cytoplasm > cytosol. Following IL1 stimulation, translocation occurs from the membrane to cytosol.
  • Information by UniProt
  • Database links
  • Alternative names
    • CHTD2 antibody
    • FLJ21885 antibody
    • KIAA0733 antibody
    • MAP3K7IP2 antibody
    • Mitogen activated protein kinase kinase kinase 7 interacting protein 2 antibody
    • Mitogen-activated protein kinase kinase kinase 7-interacting protein 2 antibody
    • OTTHUMP00000040125 antibody
    • TAB 2 antibody
    • TAB-2 antibody
    • Tab2 antibody
    • TAB2_HUMAN antibody
    • TAK1 binding protein 2 antibody
    • TAK1-binding protein 2 antibody
    • TGF beta activated kinase 1/MAP3K7 binding protein 2 antibody
    • TGF-beta-activated kinase 1 and MAP3K7-binding protein 2 antibody
    • TGF-beta-activated kinase 1-binding protein 2 antibody
    see all

Images

  • All lanes : Anti-TAB2 antibody (ab172412) at 1 µg/ml

    Lane 1 : TAB2 transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    All lanes : Goat Anti-Mouse IgG (H&L)-HRP Conjugate secondary antibody at 1/2500 dilution

    Predicted band size: 76 kDa

References

This product has been referenced in:
  • Shi Y  et al. Overexpression of miR-155-5p Inhibits the Proliferation and Migration of IL-13-Induced Human Bronchial Smooth Muscle Cells by Suppressing TGF-ß-Activated Kinase 1/MAP3K7-Binding Protein 2. Allergy Asthma Immunol Res 10:260-267 (2018). Read more (PubMed: 29676073) »
  • Lin Y & Luo Z NLRP6 facilitates the interaction between TAB2/3 and TRIM38 in rheumatoid arthritis fibroblast-like synoviocytes. FEBS Lett 591:1141-1149 (2017). WB ; Human . Read more (PubMed: 28295271) »

See all 3 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172412.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up