Overview

  • Product nameAnti-TAF3 antibody
    See all TAF3 primary antibodies
  • Description
    Rabbit polyclonal to TAF3
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Rat, Rabbit, Guinea pig, Drosophila melanogaster, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region from internal sequence amino acids 540-589 (

    RDREREKDKNKDKSKEKDKVKEKEKDKETGRETKYPWKEFLKEEEADPYK

    ) of Human TAF3 (NP_114129)

  • Positive control
    • HepG2 Cell lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Associated products

Applications

Our Abpromise guarantee covers the use of ab85419 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 104 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionTranscription factor TFIID is one of the general factors required for accurate and regulated initiation by RNA polymerase II. TFIID is a multimeric protein complex that plays a central role in mediating promoter responses to various activators and repressors. Required in complex with TBPL2 for the differentiation of myoblasts into myocytes. The complex replaces TFIID at specific promoters at an early stage in the differentiation process.
  • Sequence similaritiesBelongs to the TAF3 family.
    Contains 1 PHD-type zinc finger.
  • DomainThe PHD-type zinc finger mediates binding to histone H3 methyllysine at position 4 (H3K4me3).
  • Cellular localizationNucleus.
  • Information by UniProt
  • Database links
    see all
  • Alternative names
    • 140 kDa TATA box-binding protein-associated factor antibody
    • Bip2 protein antibody
    • RNA polymerase II transcription factor TAFII140 antibody
    • TAF(II)140 antibody
    • TAF140 antibody
    • TAF3 antibody
    • TAF3 RNA polymerase II TATA box binding protein (TBP)-associated factor antibody
    • TAF3_HUMAN antibody
    • TAFII-140 antibody
    • TAFII140 antibody
    • TAFII155 protein antibody
    • TATA box binding protein associated factor 3 antibody
    • TBP-associated factor 3 antibody
    • Transcription initiation factor TFIID 140 kDa subunit antibody
    • Transcription initiation factor TFIID subunit 3 antibody
    see all

Anti-TAF3 antibody images

  • Anti-TAF3 antibody (ab85419) at 1 µg/ml (in 5% skim milk / PBS buffer) + HepG2 Cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 104 kDa
    Observed band size : 92 kDa (why is the actual band size different from the predicted?)

References for Anti-TAF3 antibody (ab85419)

ab85419 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab85419.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"