Overview

  • Product nameAnti-TAF5 antibody - ChIP Grade
    See all TAF5 primary antibodies
  • Description
    Mouse polyclonal to TAF5 - ChIP Grade
  • Tested applicationsSuitable for: WB, ChIPmore details
  • Species reactivity
    Reacts with: Drosophila melanogaster
  • Immunogen

    Fusion protein:

    TWSCVVTYRGHVYPVWDVRFAPHGYYFVSCSYDKTARLWATDSNQALRVF VGHLSDVDCVQFHPNSNYVATGSSDRTVRLWDNMTGQSVRLMTGHKGSVS

    , corresponding to amino acids 481-580 of Drosophila melanogaster TAF5.

  • General notes

    Produced from outbred CD1 mice.

    This antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al. PubMed: 1545867; Chambers and Johnston PubMed: 12910245; Barry and Johnston PubMed: 9234514). The animal`s cells produce the protein, which stimulates the animal`s immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage bufferConstituent: 50% Glycerol
  • PurityWhole antiserum
  • Primary antibody notesThis antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al. PubMed: 1545867; Chambers and Johnston PubMed: 12910245; Barry and Johnston PubMed: 9234514). The animal`s cells produce the protein, which stimulates the animal`s immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab21765 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Predicted molecular weight: 79 kDa.
ChIP Use at an assay dependent concentration. PubMed: 20097756

Target

  • RelevanceTAF5 is a multimeric protein complex that plays a central role in mediating promoter responses to various activators and repressors. It may play a role in helping to anchor Taf4 within the TFIID complex. It may be involved in transducing signals from various transcriptional regulators to the RNA polymerase II transcription machinery. TAF5 belongs to the TFIID complex which is composed of TATA binding protein (Tbp) and a number of TBP-associated factors (Tafs).
  • Cellular localizationNuclear
  • Alternative names
    • fc38g05 antibody
    • MGC123129 antibody
    • p85 antibody
    • TAF(II)100 antibody
    • TAF2D antibody
    • TAF5 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 100kDa antibody
    • TAFII 80 antibody
    • TAFII100 antibody
    • TATA box binding protein (TBP)-associated factor 2D antibody
    • TATA box binding protein (TBP)-associated factor, RNA polymerase II, D, 100kD antibody
    • TBP-associated factor, RNA polymerase II, 100-KD antibody
    • Transcription initiation factor TFIID 100 kDa subunit antibody
    • Transcription initiation factor TFIID 85 kDa subunit antibody
    • Transcription initiation factor TFIID subunit 5 antibody
    • wu:fc38g05 antibody
    • zgc:123129 antibody
    see all

References for Anti-TAF5 antibody - ChIP Grade (ab21765)

This product has been referenced in:
  • Lee MC  et al. Drosophila octamer elements and Pdm-1 dictate the coordinated transcription of core histone genes. J Biol Chem 285:9041-53 (2010). ChIP ; Drosophila melanogaster . Read more (PubMed: 20097756) »

See 1 Publication for this product

Product Wall

There are currently no Abreviews or Questions for ab21765.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"