Overview

  • Product nameAnti-TAF5L antibody
    See all TAF5L primary antibodies
  • Description
    Rabbit polyclonal to TAF5L
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 432 - 481 (

    VKFHPNSNYLATGSTDKTVRLWSAQQGNSVRLFTGHRGPVLSLAFSPNGK

    ) of Human TAF5L (NP_055224).

  • Positive control
    • Fetal stomach lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab90267 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 66 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionFunctions as a component of the PCAF complex. The PCAF complex is capable of efficiently acetylating histones in a nucleosomal context. The PCAF complex could be considered as the human version of the yeast SAGA complex.
  • Sequence similaritiesBelongs to the WD repeat TAF5 family.
    Contains 6 WD repeats.
  • Cellular localizationNucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • 1110005N04Rik antibody
    • AI849020 antibody
    • OTTHUMP00000037470 antibody
    • OTTHUMP00000037471 antibody
    • PAF65 beta antibody
    • PAF65-beta antibody
    • PAF65B antibody
    • PCAF associated factor 65 beta antibody
    • PCAF-associated factor 65 beta antibody
    • TAF 5L antibody
    • TAF5 like RNA polymerase II p300/CBP associated factor (PCAF) associated factor 65 kD antibody
    • TAF5 like RNA polymerase II p300/CBP associated factor (PCAF) associated factor 65 kDa antibody
    • TAF5 like RNA polymerase II p300/CBP associated factor (PCAF) associated factor antibody
    • TAF5 like RNA polymerase II p300/CBP associated factor associated factor 65 kDa subunit 5L antibody
    • TAF5 like RNA polymerase II p300/CBP associated factor associated factor 65kDa antibody
    • TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L antibody
    • Taf5l antibody
    • Taf5l protein antibody
    • TAF5L_HUMAN antibody
    see all

Anti-TAF5L antibody images

  • Anti-TAF5L antibody (ab90267) at 1 µg/ml + Human fetal stomach lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 66 kDa

References for Anti-TAF5L antibody (ab90267)

ab90267 has not yet been referenced specifically in any publications.

Product Wall

Application Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Blocking step BSA as blocking agent for 30 minute(s) · Concentration: 1.4% · Temperature: RT°C
Antigen retrieval step Heat mediated - Buffer/Enzyme Used: pH 6 - pH 9
Sample Mouse Tissue sections (Testis)
Specification Testis
Permeabilization No
Fixative Formaldehyde
Username

Abcam user community

Verified customer

Submitted Apr 30 2014

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"