Overview

  • Product nameAnti-TAF6L antibody
    See all TAF6L primary antibodies
  • Description
    Rabbit polyclonal to TAF6L
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Rat
    Predicted to work with: Mouse, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide, corresponding to a region within internal sequence amino acids 180-229 (

    PQLMKVALQDLQTNSKIAALLPYFVYVVSGVKSVSHDLEQLHRLLQVARS

    ) of Rat TAF6L (NP_001101045).

  • Positive control
    • Rat brain lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab113831 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 68 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • RelevanceTAF6L is a protein that is a component of the PCAF histone acetylase complex and structurally similar to one of the histone-like TAFs, TAF6. The PCAF histone acetylase complex, which is composed of more than 20 polypeptides some of which are TAFs, is required for myogenic transcription and differentiation.
  • Cellular localizationNuclear
  • Database links
  • Alternative names
    • CBP associated factor associated factor 65 kDa subunit 6L antibody
    • PAF65 alpha antibody
    • PAF65A antibody
    • PCAF associated factor 65 alpha antibody
    • TAF6 like RNA polymerase II p300/CBP associated factor associated factor 65 kDa subunit 6L antibody
    • TAF6-like RNA polymerase II p300 antibody
    see all

Anti-TAF6L antibody images

  • Anti-TAF6L antibody (ab113831) at 1 µg/ml + Rat brain lysate at 10 µg

    Predicted band size : 68 kDa

References for Anti-TAF6L antibody (ab113831)

ab113831 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113831.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"