Overview

  • Product nameAnti-TAF9 antibody
    See all TAF9 primary antibodies
  • Description
    Mouse polyclonal to TAF9
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Saccharomyces cerevisiae
  • Immunogen

    Fusion protein:

    MNGGGKNVLNKNSVGSVSEVGPDSTQEETPRDV

    , corresponding to amino acids 1/33 of Saccharomyces cerevisiae TAF9

  • General notesProduced from outbred CD1 mice


    This antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al. PubMed: 1545867; Chambers and Johnston PubMed: 12910245; Barry and Johnston PubMed: 9234514). The animal`s cells produce the protein, which stimulates the animal`s immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.
  • Storage bufferPreservative: None
    Constituents: 50% Glycine
  • PurityWhole antiserum
  • Primary antibody notesThis antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al. PubMed: 1545867; Chambers and Johnston PubMed: 12910245; Barry and Johnston PubMed: 9234514). The animal`s cells produce the protein, which stimulates the animal`s immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab24428 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Predicted molecular weight: 17 kDa.

This antibody has been tested in Western blot against an E.coli lysate containing the partial recombinant fusion protein used as an immunogen. We have no data on detection of endogenous protein.

Target

  • RelevanceTAF9 functions as a component of the DNA-binding general transcription factor complex TFIID and the regulatory transcription complex SAGA. Binding of TFIID to a promoter (with or without TATA element) is the initial step in pre-initiation complex (PIC) formation. TFIID plays a key role in the regulation of gene expression by RNA polymerase II through different activities such as transcription activator interaction, core promoter recognition and selectivity, TFIIA and TFIIB interaction, chromatin modification (histone acetylation by TAF1), facilitation of DNA opening and initiation of transcription. SAGA influences RNA polymerase II transcriptional activity through different activities such as TBP interaction (SPT3 and SPT8) and promoter selectivity, interaction with transcription activators (GCN5, ADA2, ADA3, and TRA1), and chromatin modification through histone acetylation (GCN5).
  • Cellular localizationNuclear
  • Alternative names
    • TAF9 RNA polymerase II, TATA box-binding protein-associated factor, 32kDa antibody
    • MGC:1603 antibody
    • MGC:3647 antibody
    • MGC:5067 antibody
    • RNA polymerase II TBP-associated factor subunit G antibody
    • STAF31/32 antibody
    • TAF17 antibody
    • TAF2G antibody
    • TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa antibody
    • TAFII31 antibody
    • TAFII32 antibody
    • TAFIID32 antibody
    • TATA box-binding protein-associated factor 2G antibody
    • TBP associated factor 17 kDa antibody
    • TBP associated factor 9 antibody
    • TBP associated factor, RNA polymerase II, 32-KD antibody
    • transcription initiation factor TFIID 31 kD subunit antibody
    • transcription initiation factor TFIID 31 kDa subunit antibody
    • transcription initiation factor TFIID 32 kDa subunit antibody
    • Transcription initiation factor TFIID subunit 9 antibody
    see all

Anti-TAF9 antibody images

  • All lanes : Anti-TAF9 antibody (ab24428) at 1/1000 dilution

    Lane 1 : Total protein extract from E. coli with ~50ng to 100ng of a negative control fusion protein with an irrelevant antigen at 20 ug
    Lane 2 : Total protein extract from E. coli with ~50ng to 500ng of the antigen fusion protein at 20 ug

    Secondary
    Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated at 1/5000 dilution

    Predicted band size : 17 kDa

References for Anti-TAF9 antibody (ab24428)

ab24428 has not yet been referenced specifically in any publications.

Product Wall

Thank you for your call today and for letting us know about the trouble with this antibody.

As we discussed, I'm sending a free of charge vial of ab24072 on the order ***, which should arrive next week.

Please keep me updated about ...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"