Overview

  • Product nameAnti-Tankyrase antibody
    See all Tankyrase primary antibodies
  • Description
    Rabbit polyclonal to Tankyrase
  • Tested applicationsSuitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within the internal amino acids 1080-1129 (

    IKGVERLLGGQQGTNPYLTFHCVNQGTILLDLAPEDKEYQSVEEEMQSTI

    ) of Human Tankyrase (NP_003738).

  • Positive control
    • 721_B cell lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab86279 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use at an assay dependent concentration.
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 142 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionMay regulate vesicle trafficking and modulate the subcellular distribution of SLC2A4/GLUT4-vesicles. Has PARP activity and can modify TERF1, and thereby contribute to the regulation of telomere length.
  • Tissue specificityUbiquitous; highest levels in testis.
  • Sequence similaritiesContains 15 ANK repeats.
    Contains 1 PARP catalytic domain.
    Contains 1 SAM (sterile alpha motif) domain.
  • Post-translational
    modifications
    Phosphorylated on serine residues by MAPK kinases upon insulin stimulation.
    ADP-ribosylated (-auto).
  • Cellular localizationCytoplasm. Golgi apparatus membrane. Chromosome > centromere. Nucleus > nuclear pore complex. Chromosome > telomere. Associated with the Golgi and with juxtanuclear SLC2A4/GLUT4-vesicles. A minor proportion is also found at nuclear pore complexes and around the pericentriolar matrix of mitotic centromeres. During interphase, a small fraction of TNKS is found in the nucleus, associated with TERF1.
  • Information by UniProt
  • Database links
  • Alternative names
    • ADP-ribosyltransferase diphtheria toxin-like 5 antibody
    • OTTHUMP00000115550 antibody
    • OTTHUMP00000224675 antibody
    • PARP 5a antibody
    • PARP5A antibody
    • PARPL antibody
    • pART5 antibody
    • Poly [ADP-ribose] polymerase 5A antibody
    • TANK 1 antibody
    • TANK1 antibody
    • Tankyrase 1 antibody
    • Tankyrase I antibody
    • Tankyrase TRF1 interacting ankyrin related ADP ribose polymerase antibody
    • Tankyrase-1 antibody
    • Tankyrase1 antibody
    • TankyraseI antibody
    • TIN 1 antibody
    • TIN1 antibody
    • TINF 1 antibody
    • TINF1 antibody
    • TNKS 1 antibody
    • TNKS antibody
    • TNKS-1 antibody
    • TNKS1 antibody
    • TNKS1_HUMAN antibody
    • TRF1 interacting ankyrin related ADP ribose polymerase antibody
    • TRF1-interacting ankyrin-related ADP-ribose polymerase antibody
    see all

Anti-Tankyrase antibody images

  • Anti-Tankyrase antibody (ab86279) at 1 µg/ml (5% skim milk/ PBS buffer) + 721_B cell lysate at 10 µg with gel concentration: 6-18%

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 142 kDa
    Observed band size : 142 kDa
    Additional bands at : <40 kDa. We are unsure as to the identity of these extra bands.

References for Anti-Tankyrase antibody (ab86279)

ab86279 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab86279.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"