Overview

  • Product name
  • Description
    Rabbit polyclonal to Tankyrase
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within the internal amino acids 1080-1129 (

    IKGVERLLGGQQGTNPYLTFHCVNQGTILLDLAPEDKEYQSVEEEMQSTI

    ) of Human Tankyrase (NP_003738).

  • Positive control
    • 721_B cell lysate

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab86279 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use at an assay dependent concentration.
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 142 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function
    May regulate vesicle trafficking and modulate the subcellular distribution of SLC2A4/GLUT4-vesicles. Has PARP activity and can modify TERF1, and thereby contribute to the regulation of telomere length.
  • Tissue specificity
    Ubiquitous; highest levels in testis.
  • Sequence similarities
    Contains 15 ANK repeats.
    Contains 1 PARP catalytic domain.
    Contains 1 SAM (sterile alpha motif) domain.
  • Post-translational
    modifications
    Phosphorylated on serine residues by MAPK kinases upon insulin stimulation.
    ADP-ribosylated (-auto).
  • Cellular localization
    Cytoplasm. Golgi apparatus membrane. Chromosome > centromere. Nucleus > nuclear pore complex. Chromosome > telomere. Associated with the Golgi and with juxtanuclear SLC2A4/GLUT4-vesicles. A minor proportion is also found at nuclear pore complexes and around the pericentriolar matrix of mitotic centromeres. During interphase, a small fraction of TNKS is found in the nucleus, associated with TERF1.
  • Information by UniProt
  • Database links
  • Alternative names
    • ADP-ribosyltransferase diphtheria toxin-like 5 antibody
    • OTTHUMP00000115550 antibody
    • OTTHUMP00000224675 antibody
    • PARP 5a antibody
    • PARP5A antibody
    • PARPL antibody
    • pART5 antibody
    • Poly [ADP-ribose] polymerase 5A antibody
    • TANK 1 antibody
    • TANK1 antibody
    • Tankyrase 1 antibody
    • Tankyrase I antibody
    • Tankyrase TRF1 interacting ankyrin related ADP ribose polymerase antibody
    • Tankyrase-1 antibody
    • Tankyrase1 antibody
    • TankyraseI antibody
    • TIN 1 antibody
    • TIN1 antibody
    • TINF 1 antibody
    • TINF1 antibody
    • TNKS 1 antibody
    • TNKS antibody
    • TNKS-1 antibody
    • TNKS1 antibody
    • TNKS1_HUMAN antibody
    • TRF1 interacting ankyrin related ADP ribose polymerase antibody
    • TRF1-interacting ankyrin-related ADP-ribose polymerase antibody
    see all

Images

  • Anti-Tankyrase antibody (ab86279) at 1 µg/ml (5% skim milk/ PBS buffer) + 721_B cell lysate at 10 µg with gel concentration: 6-18%

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 142 kDa
    Observed band size : 142 kDa
    Additional bands at : <40 kDa. We are unsure as to the identity of these extra bands.

References

This product has been referenced in:
  • Gu M  et al. RhoA phosphorylation mediated by Rho/RhoA-associated kinase pathway improves the anti-freezing potentiality of murine hatched and diapaused blastocysts. Sci Rep 7:6705 (2017). Read more (PubMed: 28751650) »
  • DaRosa PA  et al. Allosteric activation of the RNF146 ubiquitin ligase by a poly(ADP-ribosyl)ation signal. Nature 517:223-6 (2015). Read more (PubMed: 25327252) »

See all 2 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab86279.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up