Anti-TAP2 antibody (ab180611)
Key features and details
- Rabbit polyclonal to TAP2
- Suitable for: WB, ICC/IF, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-TAP2 antibody
See all TAP2 primary antibodies -
Description
Rabbit polyclonal to TAP2 -
Host species
Rabbit -
Tested applications
Suitable for: WB, ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat -
Immunogen
Recombinant fragment corresponding to Human TAP2 aa 430-680.
Sequence:YGDMLSNVGAAEKVFSYMDRQPNLPSPGTLAPTTLQGVVKFQDVSFAYPN RPDRPVLKGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQVLL DEKPISQYEHCYLHSQVVSVGQEPVLFSGSVRNNIAYGLQSCEDDKVMAA AQAAHADDFIQEMEHGIYTDVGEKGSQLAAGQKQRLAIARALVRDPRVLI LDEATSALDVQCEQALQDWNSRGDRTVLVIAHRLQTVQRAHQILVLQEGK L
Database link: Q03519 -
Positive control
- Recombinant Human TAP2 protein (ab132658) can be used as a positive control in WB. Human placenta extract.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 49% PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab180611 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | (1) |
1/500 - 1/2000. Predicted molecular weight: 76 kDa.
|
ICC/IF |
Use at an assay dependent concentration.
|
|
IHC-P |
Use at an assay dependent concentration.
ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody. |
Notes |
---|
WB
1/500 - 1/2000. Predicted molecular weight: 76 kDa. |
ICC/IF
Use at an assay dependent concentration. |
IHC-P
Use at an assay dependent concentration. ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody. |
Target
-
Function
Involved in the transport of antigens from the cytoplasm to the endoplasmic reticulum for association with MHC class I molecules. Also acts as a molecular scaffold for the final stage of MHC class I folding, namely the binding of peptide. Nascent MHC class I molecules associate with TAP via tapasin. Inhibited by the covalent attachment of herpes simplex virus ICP47 protein, which blocks the peptide-binding site of TAP. Inhibited by human cytomegalovirus US6 glycoprotein, which binds to the lumenal side of the TAP complex and inhibits peptide translocation by specifically blocking ATP-binding to TAP1 and prevents the conformational rearrangement of TAP induced by peptide binding. Inhibited by human adenovirus E3-19K glycoprotein, which binds the TAP complex and acts as a tapasin inhibitor, preventing MHC class I/TAP association. -
Involvement in disease
Bare lymphocyte syndrome 1 -
Sequence similarities
Belongs to the ABC transporter superfamily. ABCB family. MHC peptide exporter (TC 3.A.1.209) subfamily.
Contains 1 ABC transmembrane type-1 domain.
Contains 1 ABC transporter domain. -
Domain
The peptide-binding site is shared between the cytoplasmic loops of TAP1 and TAP2. -
Cellular localization
Endoplasmic reticulum membrane. The transmembrane segments seem to form a pore in the membrane. - Information by UniProt
-
Database links
- Entrez Gene: 6891 Human
- Entrez Gene: 21355 Mouse
- Entrez Gene: 24812 Rat
- Omim: 170261 Human
- SwissProt: Q03519 Human
- SwissProt: P36371 Mouse
- SwissProt: P36372 Rat
- Unigene: 502 Human
see all -
Alternative names
- ABC transporter, MHC 2 antibody
- ABC18 antibody
- ABCB3 antibody
see all
Images
-
All lanes : Anti-TAP2 antibody (ab180611) at 1/500 dilution
Lane 1 : Wild-type A431 Treated IFNgamma (10 ng/mL, 16 h) cell lysate
Lane 2 : Tap2 knockout A431 Treated IFNgamma (10 ng/mL, 16 h) cell lysate
Lane 3 : Wild-type A431 Vehicle control IFNgamma (0 ng/mL, 16 h) cell lysate
Lane 4 : Tap2 knockout A431 Vehicle control IFNgamma (0 ng/mL, 16 h) cell lysate
Lane 5 : HeLa cell lysate
Lysates/proteins at 20 µg per lane.
Performed under reducing conditions.
Predicted band size: 76 kDa
Observed band size: 70 kDa why is the actual band size different from the predicted?False colour image of Western blot: Anti-TAP2 antibody staining at 1/500 dilution, shown in green; Mouse anti-GAPDH antibody [6C5] (ab8245) loading control staining at 1/20000 dilution, shown in red. In Western blot, ab180611 was shown to bind specifically to TAP2. A band was observed at 70 kDa in treated wild-type A431 cell lysates with no signal observed at this size in Tap2 knockout cell line ab269617 (knockout cell lysate ab272427). To generate this image, wild-type and Tap2 knockout A431 cell lysates were analysed. First, samples were run on an SDS-PAGE gel then transferred onto a nitrocellulose membrane. Membranes were blocked in 3 % milk in TBS-0.1 % Tween® 20 (TBS-T) before incubation with primary antibodies overnight at 4 °C. Blots were washed four times in TBS-T, incubated with secondary antibodies for 1 h at room temperature, washed again four times then imaged. Secondary antibodies used were Goat anti-Rabbit IgG H&L 800CW and Goat anti-Mouse IgG H&L 680RD at 1/20000 dilution.
-
All lanes : Anti-TAP2 antibody (ab180611) at 1/500 dilution
Lane 1 : Wild-type HeLa cell lysate
Lane 2 : Tap2 knockout HeLa cell lysate
Lysates/proteins at 20 µg per lane.
Performed under reducing conditions.
Predicted band size: 76 kDa
Observed band size: 75 kDa why is the actual band size different from the predicted?False colour image of Western blot: Anti-TAP2 antibody staining at 1/500 dilution, shown in green; Mouse anti-GAPDH antibody [6C5] (ab8245) loading control staining at 1/20000 dilution, shown in red. In Western blot, ab180611 was shown to bind specifically to TAP2. A band was observed at 75 kDa in wild-type HeLa cell lysates with no signal observed at this size in Tap2 knockout cell line ab265426 (knockout cell lysate ab258712). To generate this image, wild-type and Tap2 knockout HeLa cell lysates were analysed. First, samples were run on an SDS-PAGE gel then transferred onto a nitrocellulose membrane. Membranes were blocked in 3 % milk in TBS-0.1 % Tween® 20 (TBS-T) before incubation with primary antibodies overnight at 4 °C. Blots were washed four times in TBS-T, incubated with secondary antibodies for 1 h at room temperature, washed again four times then imaged. Secondary antibodies used were Goat anti-Rabbit IgG H&L (IRDye® 800CW) preabsorbed (ab216773) and Goat anti-Mouse IgG H&L (IRDye® 680RD) preabsorbed (ab216776) at 1/20000 dilution.
-
Immunocytochemistry/Immunofluorescence analysis of U2OS cells using ab180611. Blue DAPI for nuclear staining.
-
Anti-TAP2 antibody (ab180611) at 1/500 dilution + Human placenta extract
Predicted band size: 76 kDa
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (4)
ab180611 has been referenced in 4 publications.
- Liang YH et al. Chemotherapy agents stimulate dendritic cells against human colon cancer cells through upregulation of the transporter associated with antigen processing. Sci Rep 11:9080 (2021). PubMed: 33907276
- Tran L et al. Cisplatin Alters Antitumor Immunity and Synergizes with PD-1/PD-L1 Inhibition in Head and Neck Squamous Cell Carcinoma. Cancer Immunol Res 5:1141-1151 (2017). PubMed: 29097421
- Wynne JW et al. Characterization of the Antigen Processing Machinery and Endogenous Peptide Presentation of a Bat MHC Class I Molecule. J Immunol 196:4468-76 (2016). PubMed: 27183594
- Dellgren C et al. Low Constitutive Cell Surface Expression of HLA-B Is Caused by a Posttranslational Mechanism Involving Glu180 and Arg239. J Immunol 197:4807-4816 (2016). PubMed: 27821669