Overview

  • Product name
  • Description
    Rabbit polyclonal to TARM1
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment within Human TARM1 aa 54-137. The exact sequence is proprietary.
    Sequence:

    RGVSFVLRKGGIILESPKPLDSTEGAAEFHLNNLKVRNAGEYTCEYYRKA SPHILSQRSDVLLLLVTGHLSKPFLRTYQRGTVT


    Database link: B6A8C7

  • Positive control
    • Human stomach tissue.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab185520 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Sequence similarities
    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
  • Cellular localization
    Membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • activating receptor on myeloid cells protein 1 antibody
    • OLT-2 antibody
    • OSCAR-like transcript-2 protein antibody
    • T cell interacting, activating receptor on myeloid cells 1 antibody
    • T-cell-interacting antibody
    • Tarm1 antibody
    • TARM1_HUMAN antibody
    see all

Images

  • Immunohistochemical analysis of formalin fixed and paraffin embedded Human stomach (lower) tissue labeling TARM1 with ab185520 at a 1/50 dilution.

References

ab185520 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185520.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up