Overview

  • Product nameAnti-TARP antibody
    See all TARP primary antibodies
  • Description
    Rabbit polyclonal to TARP
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Horse
  • Immunogen

    Synthetic peptide corresponding to a region within N-terminal amino acids 7-56 (

    YMKFSWLTVPEKSLDKEHRCIVRHENNKNGVDQEIIFPPIKTDVITMDPK

    ) of Human TARP (NP_001003806).

  • Positive control
    • Jurkat Cell Lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab113914 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 12 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • RelevanceThe TCRgamma alternate reading frame protein (TARP) gene is embedded in the TCR gamma locus and its transcript originates within an intron just upstream of the J gamma 1.2 segment. TARP, which is 58 amino acids and 7 kDa in size, is localized to the mitochondria and expressed exclusively in normal prostate, and in prostate and breast cancers. Furthermore, the expression of TARP is regulated by androgen in cell lines. There are two different isoforms.
  • Database links
  • Alternative names
    • CD3G antibody
    • T cell receptor gamma alternate reading frame protein antibody
    • T cell receptor gamma chain antibody
    • T-cell receptor gamma-chain constant region antibody
    • TARP antibody
    • TCR gamma alternate reading frame protein antibody
    • TCRG antibody
    • TCRGC1 antibody
    • TCRGC2 antibody
    see all

Anti-TARP antibody images

  • Anti-TARP antibody (ab113914) at 1 µg/ml + Jurkat Cell Lysate at 10 µg

    Predicted band size : 12 kDa

References for Anti-TARP antibody (ab113914)

ab113914 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113914.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"