Anti-Tartrate Resistant Acid Phosphatase antibody [7E6A11] (ab181468)
Key features and details
- Mouse monoclonal [7E6A11] to Tartrate Resistant Acid Phosphatase
- Suitable for: IHC-P, WB
- Reacts with: Human, Recombinant fragment
- Isotype: IgG1
Overview
-
Product name
Anti-Tartrate Resistant Acid Phosphatase antibody [7E6A11]
See all Tartrate Resistant Acid Phosphatase primary antibodies -
Description
Mouse monoclonal [7E6A11] to Tartrate Resistant Acid Phosphatase -
Host species
Mouse -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Human, Recombinant fragment
Predicted to work with: Mouse, Rat -
Immunogen
Recombinant fragment corresponding to Human Tartrate Resistant Acid Phosphatase aa 221-325. (Expressed in E.coli).
Sequence:VKQLRPLLATYGVTAYLCGHDHNLQYLQDENGVGYVLSGAGNFMDPSKRH QRKVPNGYLRFHYGTEDSLGGFAYVEISSKEMTVTYIEASGKSLFKTRLP RRARP
Database link: P13686 -
Positive control
- T47D, HepG2, MOLT4, Jurkat and Hela cell lysates; Human TRAP 5 recombinant protein; TRAP 5 (aa 221-325)-hIgGFc transfected HEK293 cell lysate; Human liver cancer tissue.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.05% Sodium azide
Constituent: 99% PBS
Contains 0.5% protein stabilizer -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purified from tissue culture supernatant. -
Clonality
Monoclonal -
Clone number
7E6A11 -
Isotype
IgG1 -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
- T-47D whole cell lysate (ab14899)
- HeLa whole cell lysate (ab150035)
- Hep G2 whole cell lysate (ab166833)
- HeLa whole cell lysate (ab29545)
- Jurkat whole cell lysate (ab30128)
- A-431 whole cell lysate (ab30132)
- Jurkat whole cell lysate (ab7899)
- A-431 whole cell lysate (ab7909)
- MOLT-4 whole cell lysate (ab7912)
-
Recombinant Protein
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab181468 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P |
1/200 - 1/1000.
|
|
WB |
1/500 - 1/2000. Predicted molecular weight: 37 kDa.
|
Notes |
---|
IHC-P
1/200 - 1/1000. |
WB
1/500 - 1/2000. Predicted molecular weight: 37 kDa. |
Target
-
Function
Involved in osteopontin/bone sialoprotein dephosphorylation. Its expression seems to increase in certain pathological states such as Gaucher and Hodgkin diseases, the hairy cell, the B-cell, and the T-cell leukemias. -
Sequence similarities
Belongs to the metallophosphoesterase superfamily. Purple acid phosphatase family. -
Cellular localization
Lysosome. - Information by UniProt
-
Database links
- Entrez Gene: 54 Human
- Entrez Gene: 11433 Mouse
- Entrez Gene: 25732 Rat
- Omim: 171640 Human
- SwissProt: P13686 Human
- SwissProt: Q05117 Mouse
- SwissProt: P29288 Rat
- Unigene: 1211 Human
see all -
Alternative names
- Type 5 acid phosphatase antibody
- Acid phosphatase 5 tartrate resistant antibody
- Acid phosphatase 5, tartrate resistant antibody
see all
Images
-
All lanes : Anti-Tartrate Resistant Acid Phosphatase antibody [7E6A11] (ab181468) at 1/500 dilution
Lane 1 : A431 cell lysate
Lane 2 : T47D cell lysate
Lane 3 : HepG2 cell lysate
Lane 4 : MOLT4 cell lysate
Lane 5 : Jurkat cell lysate
Lane 6 : Hela cell lysate
Predicted band size: 37 kDa -
All lanes : Anti-Tartrate Resistant Acid Phosphatase antibody [7E6A11] (ab181468) at 1/500 dilution
Lane 1 : Non-transfected HEK293 cell lysate
Lane 2 : TRAP 5 (aa 221-325)-hIgGFc transfected HEK293 cell lysate
Predicted band size: 37 kDa -
Anti-Tartrate Resistant Acid Phosphatase antibody [7E6A11] (ab181468) at 1/500 dilution + TRAP 5 recombinant protein
Predicted band size: 37 kDaExpected MWt is 37.3 kDa.
-
Immunohistochemical analysis of paraffin-embedded Human liver cancer tissue labeling Tartrate Resistant Acid Phosphatase with ab181468 at 1/200 dilution with DAB staining.
Protocols
Datasheets and documents
-
Datasheet download
References (2)
ab181468 has been referenced in 2 publications.
- Baxter SJ et al. Impact of pharmacologic inhibition of tooth movement on periodontal and tooth root tissues during orthodontic force application. Orthod Craniofac Res 23:35-43 (2020). PubMed: 31593373
- Sydorak I et al. Microsphere controlled drug delivery for local control of tooth movement. Eur J Orthod 41:1-8 (2019). PubMed: 29608684