Anti-Tartrate Resistant Acid Phosphatase antibody [7E6A11] (ab181468)

Overview

  • Product name
    Anti-Tartrate Resistant Acid Phosphatase antibody [7E6A11]
    See all Tartrate Resistant Acid Phosphatase primary antibodies
  • Description
    Mouse monoclonal [7E6A11] to Tartrate Resistant Acid Phosphatase
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human Tartrate Resistant Acid Phosphatase aa 221-325. (Expressed in E.coli).
    Sequence:

    VKQLRPLLATYGVTAYLCGHDHNLQYLQDENGVGYVLSGAGNFMDPSKRH QRKVPNGYLRFHYGTEDSLGGFAYVEISSKEMTVTYIEASGKSLFKTRLP RRARP


    Database link: P13686

  • Positive control
    • T47D, HepG2, MOLT4, Jurkat and Hela cell lysates; Human TRAP 5 recombinant protein; TRAP 5 (aa 221-325)-hIgGFc transfected HEK293 cell lysate; Human liver cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab181468 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/1000.
WB 1/500 - 1/2000. Predicted molecular weight: 37 kDa.

Target

  • Function
    Involved in osteopontin/bone sialoprotein dephosphorylation. Its expression seems to increase in certain pathological states such as Gaucher and Hodgkin diseases, the hairy cell, the B-cell, and the T-cell leukemias.
  • Sequence similarities
    Belongs to the metallophosphoesterase superfamily. Purple acid phosphatase family.
  • Cellular localization
    Lysosome.
  • Information by UniProt
  • Database links
  • Alternative names
    • Type 5 acid phosphatase antibody
    • Acid phosphatase 5 tartrate resistant antibody
    • Acid phosphatase 5, tartrate resistant antibody
    • ACP5 antibody
    • EC 3.1.3.2 antibody
    • MGC117378 antibody
    • PPA5_HUMAN antibody
    • serum band 5 tartrate-resistant acid phosphatase antibody
    • SPENCDI antibody
    • T5ap antibody
    • Tartrate resistant acid ATPase antibody
    • Tartrate resistant acid phosphatase type 5 antibody
    • Tartrate resistant acid phosphatase type 5 precursor antibody
    • Tartrate-resistant acid ATPase antibody
    • Tartrate-resistant acid phosphatase type 5 antibody
    • TR AP antibody
    • TR-AP antibody
    • TRACP 5 antibody
    • TRAP antibody
    • TrATPase antibody
    • Type 5 acid phosphatase antibody
    see all

Images

  • All lanes : Anti-Tartrate Resistant Acid Phosphatase antibody [7E6A11] (ab181468) at 1/500 dilution

    Lane 1 : A431 cell lysate
    Lane 2 : T47D cell lysate
    Lane 3 : HepG2 cell lysate
    Lane 4 : MOLT4 cell lysate
    Lane 5 : Jurkat cell lysate
    Lane 6 : Hela cell lysate


    Predicted band size : 37 kDa
  • All lanes : Anti-Tartrate Resistant Acid Phosphatase antibody [7E6A11] (ab181468) at 1/500 dilution

    Lane 1 : Non-transfected HEK293 cell lysate
    Lane 2 : TRAP 5 (aa 221-325)-hIgGFc transfected HEK293 cell lysate


    Predicted band size : 37 kDa
  • Anti-Tartrate Resistant Acid Phosphatase antibody [7E6A11] (ab181468) at 1/500 dilution + TRAP 5 recombinant protein

    Predicted band size : 37 kDa

    Expected MWt is 37.3 kDa.

  • Immunohistochemical analysis of paraffin-embedded Human liver cancer tissue labeling Tartrate Resistant Acid Phosphatase with ab181468 at 1/200 dilution with DAB staining.

References

ab181468 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab181468.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up