Anti-Tartrate Resistant Acid Phosphatase antibody (ab185716)

Overview

  • Product name
    Anti-Tartrate Resistant Acid Phosphatase antibody
    See all Tartrate Resistant Acid Phosphatase primary antibodies
  • Description
    Rabbit polyclonal to Tartrate Resistant Acid Phosphatase
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human Tartrate Resistant Acid Phosphatase aa 76-325.
    Sequence:

    TGVQDINDKRFQETFEDVFSDRSLRKVPWYVLAGNHDHLGNVSAQIAYSK ISKRWNFPSPFYRLHFKIPQTNVSVAIFMLDTVTLCGNSDDFLSQQPERP RDVKLARTQLSWLKKQLAAAREDYVLVAGHYPVWSIAEHGPTHCLVKQLR PLLATYGVTAYLCGHDHNLQYLQDENGVGYVLSGAGNFMDPSKRHQRKVP NGYLRFHYGTEDSLGGFAYVEISSKEMTVTYIEASGKSLFKTRLPRRARP


    Database link: P13686

  • Positive control
    • BT474, Jurkat and Mouse liver extracts.

Properties

Applications

Our Abpromise guarantee covers the use of ab185716 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 37 kDa.
IHC-P 1/50 - 1/200.
ICC/IF Use at an assay dependent concentration.

Target

  • Function
    Involved in osteopontin/bone sialoprotein dephosphorylation. Its expression seems to increase in certain pathological states such as Gaucher and Hodgkin diseases, the hairy cell, the B-cell, and the T-cell leukemias.
  • Sequence similarities
    Belongs to the metallophosphoesterase superfamily. Purple acid phosphatase family.
  • Cellular localization
    Lysosome.
  • Information by UniProt
  • Database links
  • Alternative names
    • Type 5 acid phosphatase antibody
    • Acid phosphatase 5 tartrate resistant antibody
    • Acid phosphatase 5, tartrate resistant antibody
    • ACP5 antibody
    • EC 3.1.3.2 antibody
    • MGC117378 antibody
    • PPA5_HUMAN antibody
    • serum band 5 tartrate-resistant acid phosphatase antibody
    • SPENCDI antibody
    • T5ap antibody
    • Tartrate resistant acid ATPase antibody
    • Tartrate resistant acid phosphatase type 5 antibody
    • Tartrate resistant acid phosphatase type 5 precursor antibody
    • Tartrate-resistant acid ATPase antibody
    • Tartrate-resistant acid phosphatase type 5 antibody
    • TR AP antibody
    • TR-AP antibody
    • TRACP 5 antibody
    • TRAP antibody
    • TrATPase antibody
    • Type 5 acid phosphatase antibody
    see all

Images

  • Immunocytochemistry/Immunofluorescence analysis of U2OS cells using ab185716. Blue DAPI for nuclear staining.
  • All lanes : Anti-Tartrate Resistant Acid Phosphatase antibody (ab185716) at 1/500 dilution

    Lane 1 : BT474 cell extract
    Lane 2 : Jurkat cell extract
    Lane 3 : Mouse liver extract

    Predicted band size: 37 kDa

References

ab185716 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185716.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up