Anti-Tau tubulin kinase 2 antibody (ab116096)

Overview

  • Product nameAnti-Tau tubulin kinase 2 antibody
    See all Tau tubulin kinase 2 primary antibodies
  • Description
    Rabbit polyclonal to Tau tubulin kinase 2
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse
    Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Human, Pig
  • Immunogen

    Synthetic peptide corresponding to Mouse Tau tubulin kinase 2 aa 270-319 (N terminal).
    Sequence:

    KPDYQLLTSVFDNSIKTFGVIESDPFDWEKSGTDGSLTTTTTSATPQLHT


    Database link: Q3UVR3

  • Positive control
    • Mouse thymus lysate.

Properties

Associated products

Applications

Our Abpromise guarantee covers the use of ab116096 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 137 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionSerine/threonine kinase which is able to phosphorylate tau on serines.
  • Involvement in diseaseDefects in TTBK2 are the cause of spinocerebellar ataxia type 11 (SCA11) [MIM:604432]. Spinocerebellar ataxia is a clinically and genetically heterogeneous group of cerebellar disorders. Patients show progressive incoordination of gait and often poor coordination of hands, speech and eye movements, due to degeneration of the cerebellum with variable involvement of the brainstem and spinal cord. SCA11 is an autosomal dominant cerebellar ataxia (ADCA). It is a relatively benign, late-onset, slowly progressive neurologic disorder.
  • Sequence similaritiesBelongs to the protein kinase superfamily. CK1 Ser/Thr protein kinase family.
    Contains 1 protein kinase domain.
  • Information by UniProt
  • Database links
  • Alternative names
    • KIAA0847 antibody
    • mKIAA0847 antibody
    • SCA11 antibody
    • Spinocerebellar ataxia 11 antibody
    • Tau tubulin kinase 2 antibody
    • Tau-tubulin kinase 2 antibody
    • TTBK antibody
    • TTBK 2 antibody
    • TTBK1 antibody
    • TTBK2 antibody
    • TTBK2_HUMAN antibody
    • TTK antibody
    see all

Anti-Tau tubulin kinase 2 antibody images

  • Anti-Tau tubulin kinase 2 antibody (ab116096) at 1 µg/ml + Mouse thymus lysate at 10 µg

    Predicted band size : 137 kDa

References for Anti-Tau tubulin kinase 2 antibody (ab116096)

ab116096 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116096.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"