Overview

  • Product name
  • Description
    Rabbit polyclonal to TBC1D1
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Horse, Guinea pig, Cow, Cat
  • Immunogen

    Synthetic peptide corresponding to a region within internal sequence amino acids 611-660 (RGSPGVSQRKLMRYHSVSTETPHERKDFESKANHLGDSGGTPVKTRRHS W) of Human TBC1D1 (NP_055988)

  • Positive control
    • 721_B nuclear lysate

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab84692 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 µg/ml.
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 133 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-TBC1D1 antibody images

  • Anti-TBC1D1 antibody (ab84692) at 1 µg/ml + 721_B cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 133 kDa
    Observed band size : 144 kDa (why is the actual band size different from the predicted?)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human kidney tissue labelling TBC1D1 with ab84692 at 5µg/ml.

References for Anti-TBC1D1 antibody (ab84692)

ab84692 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab84692.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up