Overview

  • Product nameAnti-TBC1D16 antibody
    See all TBC1D16 primary antibodies
  • Description
    Rabbit polyclonal to TBC1D16
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Chicken, Guinea pig, Cow, Cat, Dog, Pig, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to Human TBC1D16 aa 71-120 (N terminal).
    Sequence:

    EMLGATLILAWVPNSRIQRQDEEALRYITPESSPVRKAPRPRGRRTRSSG


    Database link: Q8TBP0

  • Positive control
    • HT1080 cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab104407 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 86 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-TBC1D16 antibody images

  • Anti-TBC1D16 antibody (ab104407) at 1 µg/ml + HT1080 cell lysate at 10 µg

    Predicted band size : 86 kDa

References for Anti-TBC1D16 antibody (ab104407)

ab104407 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab104407.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"