Overview

  • Product name
  • Description
    Mouse polyclonal to TBC1D16
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Full length protein corresponding to Human TBC1D16 aa 1-405.
    Sequence:

    MKVAPDKTCMQFSIRRPKLPSSETHPEESMYKRLGVSAWLNHLNELGQVE EEYKLRKAIFFGGIDVSIRGEVWPFLLRYYSHESTSEEREALRLQKRKEY SEIQQKRLSMTPEEHRAFWRNVQFTVDKDVVRTDRNNQFFRGEDNPNVES MRRILLNYAVYNPAVGYSQGMSDLVAPILAEVLDESDTFWCFVGLMQNTI FVSSPRDEDMEKQLLYLRELLRLTHVRFYQHLVSLGEDGLQMLFCHRWLL LCFKREFPEAEALRIWEACWAHYQTDYFHLFICVAIVAIYGDDVIEQQLA TDQMLLHFGNLAMHMNGELVLRKARSLLYQFRLLPRIPCSLHDLCKLCGS GMWDSGSMPAVECTGHHPGSESCPYGGTVEMPSPKSLREGKKGPKTPQDG FGFRR


    Database link: Q8TBP0-2

  • Positive control
    • TBC1D16 transfected 293T cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab70683 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Detects a band of approximately 47 kDa (predicted molecular weight: 47 kDa).

Target

  • Relevance
    TBC1D16 contains one Rab-GAP TBC domain. It may act as a GTPase-activating protein for Rab family protein(s).
  • Database links
  • Alternative names
    • FLJ20748 antibody
    • MGC25062 antibody
    • TBC1 domain family, member 16 antibody
    • TBC1D 16 antibody

Images

  • All lanes : Anti-TBC1D16 antibody (ab70683) at 1/500 dilution

    Lane 1 : TBC1D16 transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 25 µg per lane.

    Secondary
    Goat Anti-Mouse IgG (H&L)-HRP Conjugate at 1/2500 dilution

    Predicted band size : 47 kDa
    Observed band size : 47 kDa

References

ab70683 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab70683.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up