Overview

  • Product nameAnti-TBC1D16 antibody
    See all TBC1D16 primary antibodies
  • Description
    Mouse polyclonal to TBC1D16
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Full length protein corresponding to Human TBC1D16 aa 1-405.
    Sequence:

    MKVAPDKTCMQFSIRRPKLPSSETHPEESMYKRLGVSAWLNHLNELGQVE EEYKLRKAIFFGGIDVSIRGEVWPFLLRYYSHESTSEEREALRLQKRKEY SEIQQKRLSMTPEEHRAFWRNVQFTVDKDVVRTDRNNQFFRGEDNPNVES MRRILLNYAVYNPAVGYSQGMSDLVAPILAEVLDESDTFWCFVGLMQNTI FVSSPRDEDMEKQLLYLRELLRLTHVRFYQHLVSLGEDGLQMLFCHRWLL LCFKREFPEAEALRIWEACWAHYQTDYFHLFICVAIVAIYGDDVIEQQLA TDQMLLHFGNLAMHMNGELVLRKARSLLYQFRLLPRIPCSLHDLCKLCGS GMWDSGSMPAVECTGHHPGSESCPYGGTVEMPSPKSLREGKKGPKTPQDG FGFRR


    Database link: Q8TBP0-2

  • Positive control
    • TBC1D16 transfected 293T cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab70683 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Detects a band of approximately 47 kDa (predicted molecular weight: 47 kDa).

Target

  • RelevanceTBC1D16 contains one Rab-GAP TBC domain. It may act as a GTPase-activating protein for Rab family protein(s).
  • Database links
  • Alternative names
    • FLJ20748 antibody
    • MGC25062 antibody
    • TBC1 domain family, member 16 antibody
    • TBC1D 16 antibody

Anti-TBC1D16 antibody images

  • All lanes : Anti-TBC1D16 antibody (ab70683) at 1/500 dilution

    Lane 1 : TBC1D16 transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 25 µg per lane.

    Secondary
    Goat Anti-Mouse IgG (H&L)-HRP Conjugate at 1/2500 dilution

    Predicted band size : 47 kDa
    Observed band size : 47 kDa

References for Anti-TBC1D16 antibody (ab70683)

ab70683 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab70683.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"