Overview

  • Product nameAnti-Tbp7 antibody
    See all Tbp7 primary antibodies
  • Description
    Rabbit polyclonal to Tbp7
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Goat, Horse, Guinea pig, Cow, Cat, Dog, Saccharomyces cerevisiae, Zebrafish
  • Immunogen

    Synthetic peptide, corresponding to N terminal amino acids 1-50 (

    MEEIGILVEKAQDEIPALSVSRPQTGLSFLGPEPEDLEDLYSRYKKLQQE

    ) of Human Tbp7 (NP_006494)

  • Positive control
    • Fetal muscle lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab98330 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 46 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-Tbp7 antibody images



  • Predicted band size : 46 kDa
    Western blot analysis of proteasome fractions (10µg/lane) from C57B1/6J mouse brain (lane 1) and from BLAB/C mouse brain (lane 2) labeling Tbp7 with ab98330 at 1:500. A HRP-conjugated anti-rabbit (1:5000) was used as the secondary antibody.
  • Anti-Tbp7 antibody (ab98330) at 1 µg/ml + fetal muscle lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 46 kDa
    Gel concentration: 12%

References for Anti-Tbp7 antibody (ab98330)

ab98330 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab98330.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"