Overview

  • Product nameAnti-TCP1 alpha antibody
    See all TCP1 alpha primary antibodies
  • Description
    Rabbit polyclonal to TCP1 alpha
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within C terminal amino acids 500-549 (QAGVFEPTIVKVKSLKFATEAAITILRIDDLIKLHPESKDDKHGSYEDA V) of Human TCP1 alpha (NP_110379)

  • Positive control
    • Human placenta Lysate

Properties

Associated products

Applications

Our Abpromise guarantee covers the use of ab125407 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 60 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionMolecular chaperone; assists the folding of proteins upon ATP hydrolysis. As part of the BBS/CCT complex may play a role in the assembly of BBSome, a complex involved in ciliogenesis regulating transports vesicles to the cilia. Known to play a role, in vitro, in the folding of actin and tubulin.
  • Sequence similaritiesBelongs to the TCP-1 chaperonin family.
  • Cellular localizationCytoplasm. Cytoplasm > cytoskeleton > centrosome.
  • Information by UniProt
  • Database links
  • Alternative names
    • AI528772 antibody
    • c-cpn antibody
    • CCT alpha antibody
    • CCT antibody
    • CCT-alpha antibody
    • CCT1 antibody
    • Ccta antibody
    • CCTalpha antibody
    • D6S230E antibody
    • MGC133746 antibody
    • p63 antibody
    • T complex 1 antibody
    • T complex protein 1 alpha subunit antibody
    • T complex protein 1 antibody
    • T-complex homolog TCP1 antibody
    • T-complex protein 1 subunit alpha antibody
    • T-complex protein 1 subunit alpha B antibody
    • Tailless complex polypeptide 1 antibody
    • Tailless complex polypeptide 1A antibody
    • Tailless complex polypeptide 1B antibody
    • TCP 1 alpha antibody
    • Tcp-1 antibody
    • TCP-1-alpha antibody
    • TCP1 antibody
    • TCPA_HUMAN antibody
    • Tp63 antibody
    • TRic antibody
    see all

Anti-TCP1 alpha antibody images

  • Anti-TCP1 alpha antibody (ab125407) at 1 µg/ml + Placenta Lysate

    Predicted band size : 60 kDa

References for Anti-TCP1 alpha antibody (ab125407)

ab125407 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab125407.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"