Anti-TCP1 theta antibody (ab176691)
Key features and details
- Rabbit polyclonal to TCP1 theta
- Suitable for: WB, IP
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-TCP1 theta antibody
See all TCP1 theta primary antibodies -
Description
Rabbit polyclonal to TCP1 theta -
Host species
Rabbit -
Tested applications
Suitable for: WB, IPmore details -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Chicken, Cow, Cynomolgus monkey, Orangutan -
Immunogen
Synthetic peptide within Human TCP1 theta aa 498-548. The exact sequence is proprietary.
Sequence:LDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAGGPKPPSGKKDWDDDQN D
Database link: P50990 -
Positive control
- HeLa, 293T, Jurkat or Mouse NIH3T3 lysate.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 6.8
Preservative: 0.09% Sodium azide
Constituents: 0.1% BSA, 99% Tris buffered saline
pH: 7 to 8 -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab176691 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
1/2000 - 1/10000. Predicted molecular weight: 60 kDa.
|
|
IP |
Use at 2-10 µg/mg of lysate.
|
Notes |
---|
WB
1/2000 - 1/10000. Predicted molecular weight: 60 kDa. |
IP
Use at 2-10 µg/mg of lysate. |
Target
-
Relevance
TCP1 theta is the theta polypeptide of the CCT chaperonin molecule complex. The intact CCT complex is composed of eight polypeptides in a double ring. TCP1 theta is a molecular chaperone that assists the folding of proteins upon ATP hydrolysis. CCT is important within cells in aiding the folding of proteins including actin, tubulin and the VHL tumour suppressor protein. -
Cellular localization
Cytoplasm. Cytoplasm; cytoskeleton; centrosome -
Database links
- Entrez Gene: 418486 Chicken
- Entrez Gene: 281047 Cow
- Entrez Gene: 10694 Human
- Entrez Gene: 12469 Mouse
- SwissProt: Q6EE31 Chicken
- SwissProt: Q3ZCI9 Cow
- SwissProt: P50990 Human
- SwissProt: P42932 Mouse
-
Alternative names
- C21orf112 antibody
- CCT 8 antibody
- CCT theta antibody
see all
Images
-
Detection of Human TCP1 theta by Western Blot of Immunoprecipitates. 1 mg for IP; 20% of IP HeLa whole cell lysate loaded. ab176691 used for IP at 6 µg/mg lysate. For blotting immunoprecipitated TCP1 theta, ab176691 was used at 0.04 µg/ml.
-
All lanes : Anti-TCP1 theta antibody (ab176691) at 0.04 µg/ml
Lane 1 : HeLa lysate at 50 µg
Lane 2 : HeLa lysate at 15 µg
Lane 3 : 293T lysate at 50 µg
Lane 4 : Jurkat lysate at 50 µg
Lane 5 : Mouse NIH3T3 lysate at 50 µg
Developed using the ECL technique.
Predicted band size: 60 kDa
Exposure time: 10 seconds
Protocols
Datasheets and documents
-
Datasheet download
References (0)
ab176691 has not yet been referenced specifically in any publications.