Overview

  • Product name
  • Description
    Rabbit polyclonal to TCP1 theta
  • Tested applications
    Suitable for: WB, IPmore details
  • Species reactivity
    Reacts with: Mouse, Human
    Predicted to work with: Chicken, Cow, Cynomolgus monkey, Orangutan
  • Immunogen

    Synthetic peptide within Human TCP1 theta aa 498-548. The exact sequence is proprietary.
    Sequence:

    LDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAGGPKPPSGKKDWDDDQN D


    Database link: P50990

  • Positive control
    • HeLa, 293T, Jurkat or Mouse NIH3T3 lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.09% Sodium azide
    Constituents: 0.1% BSA, 99% Tris buffered saline

    pH: 7 to 8
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab176691 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 60 kDa.
IP Use at 2-10 µg/mg of lysate.

Target

  • Relevance
    TCP1 theta is the theta polypeptide of the CCT chaperonin molecule complex. The intact CCT complex is composed of eight polypeptides in a double ring. TCP1 theta is a molecular chaperone that assists the folding of proteins upon ATP hydrolysis. CCT is important within cells in aiding the folding of proteins including actin, tubulin and the VHL tumour suppressor protein.
  • Cellular localization
    Cytoplasm. Cytoplasm; cytoskeleton; centrosome
  • Database links
  • Alternative names
    • C21orf112 antibody
    • CCT 8 antibody
    • CCT theta antibody
    • CCT8 antibody
    • CCTQ antibody
    • Chaperonin containing TCP1 subunit 8 (theta) antibody
    • Chaperonin subunit 8 (Theta) (Predicted), isoform CRA_a antibody
    • Chaperonin subunit 8 (theta) antibody
    • Chromosome 21 open reading frame 112 antibody
    • D21S246 antibody
    • KIAA0002 antibody
    • PRED71 antibody
    • Renal carcinoma antigen NY REN 15 antibody
    • T complex protein 1 subunit theta antibody
    • T complex protein 1 theta subunit antibody
    • TCP 1 theta antibody
    • Tcpq antibody
    see all

Images

  • Detection of Human TCP1 theta by Western Blot of Immunoprecipitates. 1 mg for IP; 20% of IP HeLa whole cell lysate loaded. ab176691 used for IP at 6 µg/mg lysate. For blotting immunoprecipitated TCP1 theta, ab176691 was used at 0.04 µg/ml.

  • All lanes : Anti-TCP1 theta antibody (ab176691) at 0.04 µg/ml

    Lane 1 : HeLa lysate at 50 µg
    Lane 2 : HeLa lysate at 15 µg
    Lane 3 : 293T lysate at 50 µg
    Lane 4 : Jurkat lysate at 50 µg
    Lane 5 : Mouse NIH3T3 lysate at 50 µg

    Developed using the ECL technique

    Predicted band size : 60 kDa


    Exposure time : 10 seconds

References

ab176691 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab176691.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up