Anti-TCR V alpha 12.1 antibody [6D6.6] (FITC) (ab171107)

Overview

  • Product name
    Anti-TCR V alpha 12.1 antibody [6D6.6] (FITC)
  • Description
    Mouse monoclonal [6D6.6] to TCR V alpha 12.1 (FITC)
  • Host species
    Mouse
  • Conjugation
    FITC. Ex: 493nm, Em: 528nm
  • Tested applications
    Suitable for: Cellular Activation, IP, IHC-Fr, Flow Cytmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Full length protein corresponding to Human TCR V alpha 12.1 aa 1-142.
    Sequence:

    PNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTV LDMRSMDFKS NSAVAWSNKSDFACANAFNNSIIPEDTFFPSPESSCDV KLVEKSFETDTNLNFQNLSVIGFRILLLKVAGFNLLMTLRLWSS


    Database link: P01848

Properties

  • Form
    Prediluted
  • Storage instructions
    Shipped at 4°C. Store at +4°C. Store In the Dark.
  • Storage buffer
    Preservative: 0.1% Sodium azide
    Constituents: 99% PBS, 0.5% BSA
  • Concentration information loading...
  • Purity
    Protein A purified
  • Clonality
    Monoclonal
  • Clone number
    6D6.6
  • Isotype
    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab171107 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Cellular Activation Use at an assay dependent concentration.

T-Cell Activation

IP Use at an assay dependent concentration.
IHC-Fr Use at an assay dependent concentration.
Flow Cyt 1/20.

ab91356 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

 

Target

  • Relevance
    The ability of T cell receptors (TCR) to discriminate foreign from self-peptides presented by major histocompatibility complex (MHC) class II molecules is essential for an effective adaptive immune response. TCR recognition of self-peptides has been linked to autoimmune disease. Mutant self-peptides have been associated with tumors. Engagement of TCRs by a family of bacterial toxins known as superantigens has been responsible for toxic shock syndrome. Autoantibodies to V beta segments of T cell receptors have been isolated from patients with rheumatoid arthritis (RA) and systemic lupus erythematosus (SLE). The autoantibodies block TH1-mediated inflammatory autodestructive reactions and are believed to be a method by which the immune system compensates for disease.
  • Cellular localization
    Membrane; Single-pass membrane protein
  • Database links
  • Alternative names
    • TRAC antibody
    • T cell receptor alpha locus antibody
    • T-cell receptor alpha chain C region antibody
    • TCRA antibody
    • TCRD antibody
    • TRA antibody
    see all

Images

  • Flow cytometry analysis of TCR V alpha 12.1 showing positive staining in the membrane of peripheral blood mononuclear cells compared to an isotype control (blue). Human blood was collected and combined with a hydrophilic polysaccharide then centrifuged. Samples were transferred to a conical tube and washed with PBS. 50 ul of cell solution was added to each tube at a dilution of 2x10^7 cells/ml and 50 ul of isotype control and ab171107 at 1:20 added. Cells were incubated for 30 min at 4oC and washed with a cell buffer and incubated with a DyLight 488-conjugated goat anti-mouse IgG (H+L) secondary for 30 min at 4oC in the dark. FACS analysis was performed using 400 ul of cell buffer.

  • Flow cytometry analysis of TCR V alpha 12.1 showing positive staining in the membrane of peripheral blood mononuclear cells compared to an isotype control (blue). Human blood was collected and combined with a hydrophilic polysaccharide then centrifuged. Samples were transferred to a conical tube and washed with PBS. 50 ul of cell solution was added to each tube at a dilution of 2x10^7 cells/ml and 50 ul of isotype control and ab171107 at 1:20 addded. Cells were incubated for 30 min at 4oC and washed with a cell buffer and incubated with a DyLight 488-conjugated goat anti-mouse IgG (H+L) secondary for 30 min at 4oC in the dark. FACS analysis was performed using 400 ul of cell buffer.

References

ab171107 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab171107.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up