FITC Anti-TCR V beta 3.1 antibody [8F10], prediluted (ab171112)
Key features and details
- FITC Mouse monoclonal [8F10] to TCR V beta 3.1, prediluted
- Suitable for: Flow Cyt
- Reacts with: Human
- Conjugation: FITC. Ex: 493nm, Em: 528nm
- Isotype: IgG1
Overview
-
Product name
FITC Anti-TCR V beta 3.1 antibody [8F10], prediluted
See all TCR V beta 3.1 primary antibodies -
Description
FITC Mouse monoclonal [8F10] to TCR V beta 3.1, prediluted -
Host species
Mouse -
Conjugation
FITC. Ex: 493nm, Em: 528nm -
Tested applications
Suitable for: Flow Cytmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant full length protein corresponding to Human TCR V beta 3.1 aa 1-133.
Sequence:MGTSLLCWMALCLLGADHADTGVSQNPRHNITKRGQNVTFRCDPISEHNR LYWYRQTLGQ GPEFLTYFQNEAQLEKSRLLSDRFSAERPKGSFSTLEI QRTEQGDSAMYLCASSLAGLNQPQHFGDGTRLSIL
Database link: P04435 -
Positive control
- Flow Cyt: PBMC cells.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C. Store In the Dark. -
Storage buffer
Preservative: 0.1% Sodium azide
Constituents: 99% PBS, 0.5% BSA -
Concentration information loading...
-
Purity
Protein G purified -
Clonality
Monoclonal -
Clone number
8F10 -
Isotype
IgG1 -
Research areas
Associated products
-
Isotype control
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab171112 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
Flow Cyt |
Use a concentration of 200 µg/ml.
ab91356 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody. |
Notes |
---|
Flow Cyt
Use a concentration of 200 µg/ml. ab91356 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody. |
Target
-
Database links
- Entrez Gene: 6957 Human
- Omim: 186930 Human
- SwissProt: P04435 Human
-
Alternative names
- T cell receptor beta locus antibody
- T-cell receptor beta chain V region CTL-L17 antibody
- TCRB antibody
- TRB antibody
Images
-
Flow cytometry analysis of TCR V beta 3.1 in PBMC cells compared to an isotype control (blue). Human blood was collected, combined with a hydrophilic polysaccharide, centrifuged, transferred to a conical tube and washed with PBS. 50 ul of cell solution was added to each tube at a dilution of 2x10^7 cells/ml, followed by the addition of 50 ul of isotype control and primary antibody (ab171112) at a dilution of 1:20. Cells were incubated for 30 min at 4ºC and washed with a cell buffer, followed by incubation with a DyLight 488-conjugated goat anti-mouse IgG (H+L) secondary for 30 min at 4ºC in the dark. FACS analysis was performed using 400 ul of cell buffer.
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab171112 has not yet been referenced specifically in any publications.