Overview

  • Product name
    Anti-TCTA antibody
  • Description
    Rabbit polyclonal to TCTA
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 53-102 (

    IQLAWGFYGNTVTGLYHRPGLGGQNGSTPDGSTHFPSWEMAANEPLKTHR

    ) of Human TCTA (NP_071503).

  • Positive control
    • Human Fetal Stomach Lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab98063 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 11 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function
    May be required for cellular fusion during osteoclastogenesis.
  • Tissue specificity
    Ubiquitous. Highest level of expression in kidney. Present in monocytes, osteoclasts, macrophages, synoviocytes and synovial lining cells (at protein level).
  • Involvement in disease
    A chromosomal aberration involving TCTA is associated with T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(1;3)(p34;p21).
  • Sequence similarities
    Belongs to the TCTA family.
  • Cellular localization
    Membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • T-cell leukemia translocation altered gene antibody
    • T-cell leukemia translocation-altered gene protein antibody
    • T-cell leukemia translocation-associated gene protein antibody
    • Tcta antibody
    • TCTA_HUMAN antibody
    see all

Anti-TCTA antibody images

  • Anti-TCTA antibody (ab98063) at 1 µg/ml (in 5% skim milk / PBS buffer) + Human fetal stomach lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 11 kDa

References for Anti-TCTA antibody (ab98063)

ab98063 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab98063.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up