
  • Product name
    Anti-TCTE1 antibody
  • Description
    Rabbit polyclonal to TCTE1
  • Tested applications
    Suitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide, corresponding to a region within internal sequence amino acids 252-301 (CGMNFEWNLFLFTYRDCLSLAAAIKACHTLKIFKLTRSKVDDDKARIII R) of Human TCTE1, NP_872345

  • Positive control
    • HepG2 cell lysate



Our Abpromise guarantee covers the use of ab81520 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 55 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay: 1:312500.


Anti-TCTE1 antibody images

  • Anti-TCTE1 antibody (ab81520) at 1 µg/ml (in 5% skim milk / PBS buffer) + HepG2 cell lysate at 10 µg

    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 55 kDa
    Observed band size : 55 kDa
    Additional bands at : 80 kDa. We are unsure as to the identity of these extra bands.

References for Anti-TCTE1 antibody (ab81520)

ab81520 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab81520.
Please use the links above to contact us or submit feedback about this product.


Sign up