
  • Product nameAnti-TDP43 antibody
    See all TDP43 primary antibodies
  • Description
    Rabbit polyclonal to TDP43
  • Tested applicationsWB, IHC-P, IHCmore details
  • Species reactivity
    Reacts with: Mouse, Human
    Predicted to work with: Rat, Horse, Chicken, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to Human TDP43 aa 1-50 (N terminal).


  • Positive control
    • HepG2 cell lysate, Human liver and kidney tubules.



Our Abpromise guarantee covers the use of ab50930 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1.25 µg/ml. Detects a band of approximately 45 kDa (predicted molecular weight: 45 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
IHC-P Use a concentration of 4 - 8 µg/ml.
IHC Use at an assay dependent concentration. ab171870-Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.


  • FunctionDNA and RNA-binding protein which regulates transcription and splicing. Involved in the regulation of CFTR splicing. It promotes CFTR exon 9 skipping by binding to the UG repeated motifs in the polymorphic region near the 3'-splice site of this exon. The resulting aberrant splicing is associated with pathological features typical of cystic fibrosis. May also be involved in microRNA biogenesis, apoptosis and cell division. Can repress HIV-1 transcription by binding to the HIV-1 long terminal repeat. Stabilizes the low molecular weight neurofilament (NFL) mRNA through a direct interaction with the 3' UTR.
  • Tissue specificityUbiquitously expressed. In particular, expression is high in pancreas, placenta, lung, genital tract and spleen.
  • Involvement in diseaseDefects in TARDBP are the cause of amyotrophic lateral sclerosis type 10 (ALS10) [MIM:612069]. ALS is a neurodegenerative disorder affecting upper and lower motor neurons and resulting in fatal paralysis. Sensory abnormalities are absent. Death usually occurs within 2 to 5 years. The etiology of ALS is likely to be multifactorial, involving both genetic and environmental factors. The disease is inherited in 5-10% of the cases.
  • Sequence similaritiesContains 2 RRM (RNA recognition motif) domains.
  • DomainThe RRM domains can bind to both DNA and RNA.
  • Post-translational
    Hyperphosphorylated in hippocampus, neocortex, and spinal cord from individuals affected with ALS and FTLDU.
    Ubiquitinated in hippocampus, neocortex, and spinal cord from individuals affected with ALS and FTLDU.
    Cleaved to generate C-terminal fragments in hippocampus, neocortex, and spinal cord from individuals affected with ALS and FTLDU.
  • Cellular localizationNucleus. In patients with frontotemporal lobar degeneration and amyotrophic lateral sclerosis, it is absent from the nucleus of affected neurons but it is the primary component of cytoplasmic ubiquitin-positive inclusion bodies.
  • Information by UniProt
  • Database links
  • Alternative names
    • ALS10 antibody
    • OTTHUMP00000002171 antibody
    • OTTHUMP00000002172 antibody
    • OTTHUMP00000002173 antibody
    • TADBP_HUMAN antibody
    • TAR DNA binding protein 43 antibody
    • TAR DNA binding protein antibody
    • TAR DNA-binding protein 43 antibody
    • TARDBP antibody
    • TDP 43 antibody
    • TDP-43 antibody
    • TDP43 antibody
    see all

Anti-TDP43 antibody images

  • All lanes : Anti-TDP43 antibody (ab50930) at 1.25 µg/ml

    Lane 1 : HepG2 cell lysate
    Lane 2 : HepG2 cell lysate with blocking peptide at 1 µg/ml

    Lysates/proteins at 25 µg per lane.

    Predicted band size : 45 kDa
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human liver tissue labelling TARDBP with ab50930 at 4µg/ml. Magnification: X400.

  • Anti-TDP43 antibody (ab50930) at 1.25 µg/ml + HepG2 cell lysate at 10 µg

    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 45 kDa
    Observed band size : 45 kDa
    Diluted in 5% skim milk / PBS buffer, gel concentration 12%
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human kidney tissue labelling TARDBP with ab50930 at 4µg/ml. Magnification: X400.

References for Anti-TDP43 antibody (ab50930)

This product has been referenced in:
  • Ricketts T  et al. A nonsense mutation in mouse Tardbp affects TDP43 alternative splicing activity and causes limb-clasping and body tone defects. PLoS One 9:e85962 (2014). WB ; Mouse . Read more (PubMed: 24465814) »
  • Estes PS  et al. Wild-type and A315T mutant TDP-43 exert differential neurotoxicity in a Drosophila model of ALS. Hum Mol Genet 20:2308-21 (2011). WB . Read more (PubMed: 21441568) »

See all 2 Publications for this product

Product Wall

Thank you for your enquiry. We can provide you with a 50aa region from which the immunogen sequence was derived. The region is as follows: MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQC I hope this information will be useful. Should you ...

Read More