Overview

  • Product nameAnti-TDP43 antibody
    See all TDP43 primary antibodies
  • Description
    Rabbit polyclonal to TDP43
  • Tested applicationsSuitable for: IHC-P, WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Drosophila melanogaster
  • Immunogen

    Synthetic peptide corresponding to Human TDP43 aa 251-300 (internal sequence).
    Sequence:

    GISVHISNAEPKHNSNRQLERSGRFGGNPGGFGNQGGFGNSRGGGAGLGN

  • Positive control
    • Fetal muscle lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab82695 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 µg/ml.
WB Use a concentration of 1 µg/ml. Detects a band of approximately 45 kDa (predicted molecular weight: 45 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay: 1/12500.

Target

  • FunctionDNA and RNA-binding protein which regulates transcription and splicing. Involved in the regulation of CFTR splicing. It promotes CFTR exon 9 skipping by binding to the UG repeated motifs in the polymorphic region near the 3'-splice site of this exon. The resulting aberrant splicing is associated with pathological features typical of cystic fibrosis. May also be involved in microRNA biogenesis, apoptosis and cell division. Can repress HIV-1 transcription by binding to the HIV-1 long terminal repeat. Stabilizes the low molecular weight neurofilament (NFL) mRNA through a direct interaction with the 3' UTR.
  • Tissue specificityUbiquitously expressed. In particular, expression is high in pancreas, placenta, lung, genital tract and spleen.
  • Involvement in diseaseDefects in TARDBP are the cause of amyotrophic lateral sclerosis type 10 (ALS10) [MIM:612069]. ALS is a neurodegenerative disorder affecting upper and lower motor neurons and resulting in fatal paralysis. Sensory abnormalities are absent. Death usually occurs within 2 to 5 years. The etiology of ALS is likely to be multifactorial, involving both genetic and environmental factors. The disease is inherited in 5-10% of the cases.
  • Sequence similaritiesContains 2 RRM (RNA recognition motif) domains.
  • DomainThe RRM domains can bind to both DNA and RNA.
  • Post-translational
    modifications
    Hyperphosphorylated in hippocampus, neocortex, and spinal cord from individuals affected with ALS and FTLDU.
    Ubiquitinated in hippocampus, neocortex, and spinal cord from individuals affected with ALS and FTLDU.
    Cleaved to generate C-terminal fragments in hippocampus, neocortex, and spinal cord from individuals affected with ALS and FTLDU.
  • Cellular localizationNucleus. In patients with frontotemporal lobar degeneration and amyotrophic lateral sclerosis, it is absent from the nucleus of affected neurons but it is the primary component of cytoplasmic ubiquitin-positive inclusion bodies.
  • Information by UniProt
  • Database links
  • Alternative names
    • ALS10 antibody
    • OTTHUMP00000002171 antibody
    • OTTHUMP00000002172 antibody
    • OTTHUMP00000002173 antibody
    • TADBP_HUMAN antibody
    • TAR DNA binding protein 43 antibody
    • TAR DNA binding protein antibody
    • TAR DNA-binding protein 43 antibody
    • TARDBP antibody
    • TDP 43 antibody
    • TDP-43 antibody
    • TDP43 antibody
    see all

Anti-TDP43 antibody images

  • Anti-TDP43 antibody (ab82695) at 1 µg/ml + Fetal muscle lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 45 kDa
    Observed band size : 45 kDa
    Gel concentration: 12%
  • Immunohistochemistry of Thymus tissue at an antibody concentration of 5µg/ml using anti-TARDBP antibody (ab82695)



  • Predicted band size : 45 kDa
    Western Blot using ab82695 at 1.0ug/ml. Sample type: Human 293T cell Lysate


  • Predicted band size : 45 kDa
    Western Blot using ab82695 at 1.0ug/ml. Sample type: Hum. Fetal Muscle Lysate

References for Anti-TDP43 antibody (ab82695)

ab82695 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab82695.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"