Anti-TEKT3 antibody - C-terminal (ab182780)

Overview

  • Product name
    Anti-TEKT3 antibody - C-terminal
    See all TEKT3 primary antibodies
  • Description
    Rabbit polyclonal to TEKT3 - C-terminal
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human TEKT3 aa 191-490 (C terminal). (With tag; BC031688).
    Sequence:

    PLQVARECLFHREKRMGIDLVHDEVEAQLLTEVDTILCCQERMKLHLDKA IAQLAANRASQHELEKDLSDKQTAYRINDKCHHLRNTSDGVGYFRGVERV DATVSVPESWAKFTDDNILRSQSERAASAKLRDDIENLLVVTANEMWNQF NKVNLSFTNRIAETADAKNKIQTHLAKTLQEIFQTEMTIESIKKAIKDKT AFLKVAQTRLDERTRRPNIELCRDMAQLRLVNEVHEVDDTIQTLQQRLRD AEDTLQSLVHIKATLEYDLAVKANSLYIDQEKCMSMRKSYPNTLRLVGFC


    Database link: Q9BXF9

  • Positive control
    • Human fetal muscle tissue lysate and Lncap cell lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.30
    Preservative: 0.05% Sodium azide
    Constituents: 50% Glycerol, 49% PBS

    Note: PBS without Mg22+ and Ca2+.
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab182780 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200 - 1/1000. Predicted molecular weight: 57 kDa.

Target

Images

  • All lanes : Anti-TEKT3 antibody - C-terminal (ab182780) at 1/550 dilution

    Lane 1 : Human fetal muscle tissue lysate
    Lane 2 : LnCap cell lysate

    Lysates/proteins at 40 µg per lane.

    Secondary
    Goat anti Rabbit IgG - H&L (HRP) at 1/10000 dilution

    Predicted band size : 57 kDa

    Gel: 10% SDS-PAGE

References

ab182780 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182780.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up