Overview

  • Product nameAnti-TEKT4 antibody
    See all TEKT4 primary antibodies
  • Description
    Rabbit polyclonal to TEKT4
  • Tested applicationsSuitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Horse, Guinea pig, Cow, Cat, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 36-85 (

    TSKYLLEEWFQNCYARYHQAFADRDQSERQRHESQQLATETQALAQRTQQ

    ) of Human TEKT4 (NP_653306)

  • Positive control
    • HeLa cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab83818 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 51 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

Titer using peptide based assay: 1/62500.

Target

Anti-TEKT4 antibody images

  • Anti-TEKT4 antibody (ab83818) at 1 µg/ml (in 5% skim milk / PBS buffer) + HeLa cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 51 kDa
    Observed band size : 60 kDa (why is the actual band size different from the predicted?)

References for Anti-TEKT4 antibody (ab83818)

ab83818 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab83818.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"