Overview

  • Product name
  • Description
    Rabbit polyclonal to TEM1
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IPmore details
  • Species reactivity
    Reacts with: Saccharomyces cerevisiae
  • Immunogen

    Recombinant full length protein (proprietary-tag) corresponding to Saccharomyces cerevisiae TEM1 aa 1-245. Expressed in E. coli.
    Sequence:

    MATPSTGANNSIPAVRNQVEVQVGLVGDAQVGKTSLMVKYVQNIYDKEYT QTLGVNFLKRKVSIRSTDIIFSIMDLGGQREFINMLPIATVGSSVIIFLF DLTRPETLSSIKEWYRQAYGLNDSAIPILVGTKYDLLIDLDPEYQEQISR TSMKYAQVMNAPLIFCSTAKSINIQKIFKIALAKIFNLTLTIPEINEIGD PLLIYKHLGGQQHRHHNKSQDRKSHNIRKPSSSPSSKAPSPGVNT


    Database link: P38987

  • Positive control
    • Saccharomyces cerevisiae crude extract.

Properties

Applications

Our Abpromise guarantee covers the use of ab188274 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/250 - 1/500. Predicted molecular weight: 27 kDa.
IP Use at an assay dependent concentration.

Target

  • Function
    May play a role in tumor angiogenesis.
  • Tissue specificity
    Expressed in tumor endothelial cells but absent or barely detectable in normal endothelial cells. Expressed in metastatic lesions of the liver and during angiogenesis of corpus luteum formation and wound healing. Expressed in vascular endothelial cells of malignant tumors but not in normal blood vessels. Expressed in stromal fibroblasts.
  • Sequence similarities
    Contains 1 C-type lectin domain.
    Contains 1 EGF-like domain.
    Contains 1 Sushi (CCP/SCR) domain.
  • Post-translational
    modifications
    O-glycosylated with sialylated oligosaccharides.
    May be N-glycosylated.
  • Cellular localization
    Membrane.
  • Information by UniProt
  • Database links
    • Alternative names
      • CD164 sialomucin like 1 antibody
      • CD164L1 antibody
      • CD248 antibody
      • CD248 antigen endosialin antibody
      • CD248 molecule endosialin antibody
      • CD248_HUMAN antibody
      • Endosialin antibody
      • TEM 1 antibody
      • TEM1 antibody
      • Tumor endothelial marker 1 antibody
      see all

    Images

    • Anti-TEM1 antibody (ab188274) at 1/250 dilution + Saccharomyces cerevisiae crude extract

      Predicted band size: 27 kDa

    References

    ab188274 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab188274.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

    Sign up