Overview

  • Product name
  • Description
    Mouse polyclonal to Tensin 1
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Tensin 1 aa 1-352.
    Sequence:

    MSVSRTMEDSCELDLVYVTERIIAVSFPSTANEENFRSNLREVAQMLKSK HGGNYLLFNLSERRPDITKLHAKVLEFGWPDLHTPALEKICSICKAMDTW LNADPHNVVVLHNKGNRGRIGVVIAAYMHYSNISASADQALDRFAMKRFY EDKIVPIGQPSQRRYVHYFSGLLSGSIKMNNKPLFLHHVIMHGIPNFESK GGCRPFLRIYQAMQPVYTSGIYNIPGDSQTSVCITIEPGLLLKGDILLKC YHKKFRSPARDVIFRVQFHTCAIHDLGVVFGKEDLDDAFKDDRFPEYGKV EFVFSYGPEKIQGMEHLENGPSVSVDYNTSDPLIRWDSYDNFSGHRDDGM EDGNKQNTNSQSIGSISGGLEDQYTWPDTHWPSQS


    Database link: Q9HBL0

  • Positive control
    • Tensin 1 transfected 293T cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab167660 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 44 kDa.

Target

  • Function
    Involved in fibrillar adhesion formation. May be involved in cell migration, cartilage development and in linking signal transduction pathways to the cytoskeleton.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Contains 1 C2 tensin-type domain.
    Contains 1 phosphatase tensin-type domain.
    Contains 1 SH2 domain.
  • Post-translational
    modifications
    Rapidly cleaved by calpain II.
  • Cellular localization
    Cell surface. Cell junction, focal adhesion. Cytoplasm, cytoskeleton. Localized at cell periphery preferentially to fibrillar adhesions than focal adhesions. Translocates from the cell edge to cell center in an ITGB1BP1-dependent manner.
  • Information by UniProt
  • Database links
  • Alternative names
    • matrix-remodelling associated 6 antibody
    • Matrix-remodelling-associated protein 6 antibody
    • MGC88584 antibody
    • MST091 antibody
    • MST122 antibody
    • MST127 antibody
    • MSTP091 antibody
    • MSTP122 antibody
    • MSTP127 antibody
    • MXRA6 antibody
    • TENS1_HUMAN antibody
    • Tensin antibody
    • Tensin-1 antibody
    • TNS antibody
    • TNS1 antibody
    see all

Images

  • All lanes : Anti-Tensin 1 antibody (ab167660) at 1 µg/ml

    Lane 1 : Tensin 1 transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    Goat Anti-Mouse IgG HRP

    Predicted band size : 44 kDa

References

ab167660 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167660.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up