Overview

  • Product name
  • Description
    Rabbit polyclonal to TEX19
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human TEX19 aa 3-74.
    Sequence:

    PPVSMRYEEEGMSYLYASWMYQLQHGDQLSICFTCFKAAFLDFKDLLESE DWEEDNWDPELMEHTEAESEQE


    Database link: Q8NA77

  • Positive control
    • Human testis tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab185507 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance
    The specific function of TEX19 remains unknown.
  • Cellular localization
    Nuclear
  • Database links
  • Alternative names
    • FLJ35767 antibody
    • Testis expressed 19 antibody
    • Testis expressed sequence 19 protein antibody

Images

  • Immunohistochemical analysis of paraffin-embedded Human testis tissue labeling TEX19 with ab185507 at 1/500 dilution.

References

This product has been referenced in:
  • Planells-Palop V  et al. Human germ/stem cell-specific gene TEX19 influences cancer cell proliferation and cancer prognosis. Mol Cancer 16:84 (2017). Read more (PubMed: 28446200) »

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185507.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up