Overview

  • Product nameAnti-TFPI2 antibody
    See all TFPI2 primary antibodies
  • Description
    Rabbit polyclonal to TFPI2
  • Tested applicationsSuitable for: ICC/IF, WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Chicken
  • Immunogen

    Synthetic peptide corresponding to a region within internal sequence amino acids 72-121 (

    NANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQCEGSTEKYFFNLSSMT

    ) of Human TFPI2 (NP_006519)

  • Positive control
    • MCF7 cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab83470 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/200.
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 27 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

Titre using peptide based assay: 1/62500.

Target

  • FunctionMay play a role in the regulation of plasmin-mediated matrix remodeling. Inhibits trypsin, plasmin, factor VIIa/tissue factor and weakly factor Xa. Has no effect on thrombin.
  • Tissue specificityUmbilical vein endothelial cells, liver, placenta, heart, pancreas, and maternal serum at advanced pregnancy.
  • Sequence similaritiesContains 3 BPTI/Kunitz inhibitor domains.
  • DomainThis inhibitor contains three inhibitory domains.
  • Cellular localizationSecreted.
  • Information by UniProt
  • Database links
  • Alternative names
    • Placental protein 5 antibody
    • PP5 antibody
    • REF1 antibody
    • Retinal pigment epithelium cell factor 1 antibody
    • TFPI 2 antibody
    • TFPI-2 antibody
    • TFPI2 antibody
    • TFPI2 PEN antibody
    • TFPI2_HUMAN antibody
    • Tissue factor pathway inhibitor 2 antibody
    see all

Anti-TFPI2 antibody images

  • Anti-TFPI2 antibody (ab83470) at 1 µg/ml (in 5% skim milk / PBS buffer) + MCF7 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 27 kDa
    Observed band size : 28 kDa (why is the actual band size different from the predicted?)
  • Immunofluorescence analysis of Human Macrophage Cells staining TFPI2 (green/yellow) with ab83470 at 1/200 dilution. A FITC-conjugated anti-rabbit IgG (1/1000) was used as the secondary antibody. Nuclei were stained with DAPI (blue).

References for Anti-TFPI2 antibody (ab83470)

ab83470 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab83470.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"