Overview

  • Product name
  • Description
    Rabbit polyclonal to TGF alpha
  • Specificity
    The immunogen shares approximately 40% sequence homology with EGF, including 6 conserved cysteine residues, which form 3 intramolecular disulfide bonds.
  • Tested applications
    Suitable for: WB, Neutralising, Sandwich ELISA, ELISA, IHC-Pmore details
  • Species reactivity
    Reacts with: Mouse, Human
  • Immunogen

    Recombinant full length protein aa 40-89.
    Sequence:

    VVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA


    Database link: P01135
    (Peptide available as ab9587)

Properties

Applications

Our Abpromise guarantee covers the use of ab9585 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.1 - 0.2 µg/ml. Can be blocked with Recombinant TGF alpha protein (ab9587).
Neutralising Use at an assay dependent concentration.

To yield one-half maximal inhibition [ND50] of the biological activity of hTGF alpha (0.5 ng/ml), a concentration of 2.5 - 2.7 µg/ml of this antibody is required.

Sandwich ELISA Use at an assay dependent concentration.

To detect Human TGF-α by sandwich ELISA (using 100 μl/well antibody solution) a concentration of 0.5 - 2.0 μg/ml of this antibody is required. The antibody, in conjunction with biotinylated Anti-Human TGF-α ab83159 as a detection antibody, allows the detection of at least 0.2 - 0.4 ng/well of recombinant Human TGF-α.

ELISA Use a concentration of 0.5 µg/ml.
IHC-P Use a concentration of 0.25 µg/ml.

Target

  • Function
    TGF alpha is a mitogenic polypeptide that is able to bind to the EGF receptor and to act synergistically with TGF beta to promote anchorage-independent cell proliferation in soft agar.
  • Tissue specificity
    Isoform 1, isoform 3 and isoform 4 are expressed in keratinocytes and tumor-derived cell lines.
  • Sequence similarities
    Contains 1 EGF-like domain.
  • Cellular localization
    Cell membrane and Secreted > extracellular space.
  • Information by UniProt
  • Database links
  • Alternative names
    • EGF like TGF antibody
    • EGF-like TGF antibody
    • ETGF antibody
    • TFGA antibody
    • TGF A antibody
    • TGF type 1 antibody
    • TGF-alpha antibody
    • Tgfa antibody
    • TGFA_HUMAN antibody
    • Transforming growth factor alpha antibody
    • Transforming growth factor alpha precursor antibody
    • Wa1 antibody
    • Waved 1 antibody
    see all

Images

  • ab9585 at 0.25 µg/ml staining human breast invasive ductal carcinoma tissue by IHC-P.  The antibody was incubated for two hours at room temperature.  An HRP-labeled polymer detection system was used with DAB chromogen. Heat induced antigen retrieval was performed with a pH 6.0 Sodium Citrate buffer.

References

This product has been referenced in:

See all 7 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab9585.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up