Overview

  • Product name
  • Description
    Rabbit polyclonal to TGF beta 3
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Sheep, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 324 - 373 (

    FRQDLGWKWVHEPKGYYANFCSGPCPYLRSADTTHSTVLGLYNTLNPEAS

    ) of Human TGF beta 3 (NP_003230).

  • Positive control
    • SH-SYSY cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab90264 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 47 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function
    Involved in embryogenesis and cell differentiation.
  • Involvement in disease
    Defects in TGFB3 are a cause of familial arrhythmogenic right ventricular dysplasia type 1 (ARVD1) [MIM:107970]; also known as arrhythmogenic right ventricular cardiomyopathy 1 (ARVC1). ARVD is an autosomal dominant disease characterized by partial degeneration of the myocardium of the right ventricle, electrical instability, and sudden death. It is clinically defined by electrocardiographic and angiographic criteria; pathologic findings, replacement of ventricular myocardium with fatty and fibrous elements, preferentially involve the right ventricular free wall.
  • Sequence similarities
    Belongs to the TGF-beta family.
  • Cellular localization
    Secreted.
  • Information by UniProt
  • Database links
  • Alternative names
    • ARVD antibody
    • ARVD1 antibody
    • FLJ16571 antibody
    • LDS5 antibody
    • MGC105479 antibody
    • MGC118722 antibody
    • prepro-transforming growth factor beta-3 antibody
    • RNHF antibody
    • TGF beta 3 antibody
    • TGF beta3 antibody
    • TGF-beta-3 antibody
    • TGFB 3 antibody
    • Tgfb3 antibody
    • TGFB3_HUMAN antibody
    • transforming growth factor beta 3 antibody
    • Transforming growth factor beta-3 antibody
    see all

Anti-TGF beta 3 antibody images

  • Anti-TGF beta 3 antibody (ab90264) at 1 µg/ml + SH-SYSY cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 47 kDa

References for Anti-TGF beta 3 antibody (ab90264)

ab90264 has not yet been referenced specifically in any publications.

Product Wall

Application
Immunohistochemistry (PFA perfusion fixed frozen sections)
Sample
Mouse Tissue sections (Brain Tissue)
Antigen retrieval step
None
Specification
Brain Tissue
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C
Fixative
Paraformaldehyde
Username

Abcam user community

Verified customer

Submitted Oct 26 2016

Application
Immunohistochemistry (Frozen sections)
Sample
Mouse Tissue sections (Brain)
Permeabilization
Yes - 0.2% Triton X100
Specification
Brain
Blocking step
Serum as blocking agent for 2 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C
Fixative
Paraformaldehyde
Username

Abcam user community

Verified customer

Submitted Sep 21 2016

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up